Pandora's box Add to Connotea See also this set of papers for viral insertions and shared viral/human homology

Please cite these papers and this site if using these data. Thank you.

and:- Alzheimer's Disease A Pathogenetic Autoimmune Disorder Caused by Herpes Simplex in a Gene-Dependent Manner Int.J.Alz.Dis, 2010.................

Back to BLASTS

AIDS..

EXAMPLES of mechanisms of action.

PolygenicBlog on the relations between genes, risk factors and autoimmunity

 

 

Creative Commons Licence
Pandora's box by Chris Carter is licensed under a Creative Commons Attribution-NonCommercial-ShareAlike 3.0 Unported License

Enhanced links to genes are provided by Tag clouds by Tag Cloud Generator

The entire human genome is composed of viral DNA reflecting an evolutionary descent as suggested by J.B.S.Haldane and Felix D'Herelle over a century ago, and the insertion of multiple retroviral inserts over millions of years of co-existence, that are likely responsible for evolutionary jumps. These sequences are contiguous gapped segments, resulting in the translation, to protein, of millions of contiguous amino acid stretches 5-12 amino acids long (Vatches). These are homologous to proteins expressed by today's viruses and other pathogens. Viral infection will therefore interfere with host protein networks, and antibodies to the virus may also target the human homologous proteins leading to immune-related protein knockdown, and in some cases autoimmune destruction of the cells containing the human counterpart. This scenario is relevant to most, if not all, human diseases.

See this page for examples of viral incorporation into the human genome (All viruses are retroviruses)

See this page for examples of mechanisms of action including autoimmunity and interactome interference (DISC1)

See this page for an example of the many viruses that make up the exons of an individual protein (DISC1)

See this page for evidence that AIDS targets proteins of the human immune network

The results below are the raw BLAST data from various queries between viral or bacterial genes, proteins , genomes or proteomes with their human equivalents. So far only a few viruses have been examined. The prediction of millions of viral inserts within the human genome is based on almost 3000 viral genomes so far sequenced in the NCBI database and also on over 22,000 viral strains These represent but a small fraction of the strains involved. Each viral replication within each infected individual worldwide will also generate novel viral genomic DNA. The files appended here represent more than 2 million alignments and many more short homologous segments within these alignments.

Note: The Blasts returned were filtered as described in the table. Note that the BLAST results returned are subject to a cut-off value of 20,000 alignments which was generally exceeded. Usually a different set of results, as equally impressive and numerous can be returned using a different filter. For example compare the divers hits to Herpes simplex.filtered with various queries.

Vatches can easily be found by searching the phrase "identities = 7/7" or 6/6 , or 8/10 etc within the BLAST files: Those reported below are the isolated vatches and do not include those within larger sequences which have to be eyeballed individually. Genes can be found by searching for the phrase "Gene id"

Scrutiny of these files suggests several basic rules for pathogenetic diseases as discussed, and exemplified at greater length in these papers.

  1. Pathogens are implicated as risk factors in most diseases Click on this logo for each disease
  2. Viruses and other pathogens are implicated in many diseases. Click on this logo for each pathogen
  3. The pathogens implicated in the disease express proteins that are homologous to the disease related proteins (susceptibility gene products and others)
  4. The sites of genome insertion of the viruses implicated in disease correspond to the locations of the susceptibility genes in the disease (see tag clouds)
  5. All of these diseases have an autoimmune component. Click on this logo for each disease
  6. The autoantigens observed in the disease are homologous to the immunogenic proteins of the pathogens implicated in the disease (see tag clouds).
  7. All viruses cause autoimmune problems (and some vaccines) Click on this logo for each virus
  8. Pathogens cause disease by mimicry of disease related proteins, acting as dummy ligands, decoy receptors, false enzymes etc, and interfering with the interactome of their human counterparts.:
  9. Antibodies to the pathogen will target the homologous human proteins, acting as protein knockout, recreating the effects of gene knockouts, but on a massive scale.
  10. If a full-blown immune response is mounted, autoimmunity will result in destruction of the cells containing the human homologue
  11. Even if the pathogen is eliminated by the immune system, an immune response will be sustained by continued encounter with human counterparts of the viral antigen (explaining the lack of XMRV viral DNA in, for example, chronic fatigue syndrome).
  12. In these pathogenetic diseases, our genomes, mutations and polymorphisms dictate which vatches we possess, and from birth, select the viruses we match and the diseases we might develop
  13. Whole genome sequencing at birth, and pathogen matching, could predict these diseases and enable prevention.
  14. Most diseases are pathogenetic: Most are preventable via vaccination , pathogen detection and elimination and most are curable by immunosuppression, antibody adsorption or other related therapies.

TG = Translated genome HP = Human proteome;. BP = Bacterial protein; VP = Viral protein; FP = Fungal protein; YP= Yeast protein

Key

 
  • Are viruses or other pathogens implicated in the disease ? Yes in all cases : Links to Pubmed
  • Do the diseases have an autoimmune component ? Yes in all cases: Links to pubmed
  • Are autoantigens or autoantibodies found in infection by the pathogen ? Yes in all cases except XMRV which has not been tested.
  • Is the virus or pathogen implicated in human diseases ? Yes in all cases: Links to Pubmed

HSV-1 Vatch
GALRPSAA translated: The same sequence is inserted at multiple chromosomal locations suggesting multiple viral insertions over millions of years From Ensembl BLAT. These are both intra- and intergenic, the latter containing short sequences coding for "bits of protein" awaiting assembly and the addition of start and stop codons

This phenomenon appears to be responsible for the formation of gene families.

For example, the repetitive patterns on the BLAST below (HSV-1 in human) represent different human proteins from the same family, on different chromosomes

  Gene Homologous with HSV-1 Chromosome
LRP1 12q13-q14
LRP1B 2q21.2
LRP2 2q24-q31
LRP3 19q13.11
LRP4 11p11.2
LRP5 11q13.4
LRP6 12p13.2
LRP8 1p34
LRP11 6q25.1
SORL 11q23.2-q24.2
SORL1 11q23.2-q24.2
LDLR 19p13.3
VLDLR 9p24

APP: Binds to APOE and cholesterol and to LRP1: shares Fe65 proteins, LRPAP1 and MAPK8IP1 with other lipoprotein receptors; which are also cleaved by gamma-secretase

21q21.3
   
   
   

How many vatches ?

PDEDSQQTT (10aa) For a 5aa vatch N= 10-5
 
PDEDS  
..DEDSQ  
.....EDSQQ  
.......DSQQT  
..........SQQTT  

For 100,000 proteins
Average length 300 aa
(300-5)*100,000 = 29,500,000

 
Matching sequences from several thousand viruses, bacteria, amoeba, fungi, yeast and any other pathogen  
   
  • created at TagCrowd.com

     

    Alzheimer's disease

    Autoantibodies in Alzheimer's disease Viral homologues in red in progress

    Beta Amyloid

    Query Subject Filter

    Results: The size of the tags in the clouds reflect the number of pathogen homologues per human protein from the BLAST files accessible from the right hand column: Note that the profile is distinct for each virus.

    In some cases, a gene labelled as unknown in the BLAST files turned out to be APP or CR1,or NRG1 etc, and some of these errors have been rectified for the most important genes

    BLAST Files Number of significant alignments
    Herpes simplex HSV-1 NC_001806.1 Found in the Alzheimer's disease brain. HSV-1 infection causes beta-amyloid deposition, tau phosphorylation, entorhinal and hippocampal neuronal loss, cerebral shrinkage and memory deficits Autoantigens in Alzheimer's disease from and Here Tag sizes reflect the number of pathogen proteins homologous to the human protein  
    Beta-amyloid Helicobacter pylori Borrelia Cryptococcus neoformans Herpesvirus 5 Porphyromonas gingivalis Rhinovirus Human immunodeficiency virus herpesvirus 6 Herpesvirus 1 BLAST
    BPTF (Falz) Porphyromonas gingivalis Herpesvirus 6 Herpesvirus 1 Human immunodeficiency virus Borrelia Cryptococcus neoformans Helicobacter pylori Herpesvirus 5 BLAST
    AZGP1Herpesvirus 1 Herpesvirus 6 Cryptococcus neoformans Borrelia Porphyromonas gingivalis Herpesvirus 5 Helicobacter pylori Human immunodeficiency virus BLAST
    GFAP Herpesvirus 1 Herpesvirus 6 Helicobacter pylori Cryptococcus neoformans Herpesvirus 5 Human immunodeficiency virus Borrelia Porphyromonas gingivalis BLAST
    KRT10 Herpesvirus 5 Human immunodeficiency virus Porphyromonas gingivalis Borrelia Cryptococcus neoformans Herpesvirus 1 Herpesvirus 6 Helicobacter pylori BLAST
    LAMB2 Laminin BLAST
    MAPT Human immunodeficiency virus Herpesvirus 1 Cryptococcus neoformans Helicobacter pylori Porphyromonas gingivalis Borrelia Herpesvirus 6 Herpesvirus 5 BLAST
    MBPHerpesvirus 6 Helicobacter pylori Human immunodeficiency virus Herpesvirus 1 Cryptococcus neoformans Porphyromonas gingivalis Herpesvirus 5 Borrelia BLAST
    NEFH Human immunodeficiency virus Porphyromonas gingivalis Helicobacter pylori Cryptococcus neoformans Herpesvirus 5 Borrelia Herpesvirus 1 Herpesvirus 6 BLAST
    NGFHerpesvirus 1 Human immunodeficiency virus Porphyromonas gingivalis Herpesvirus 6 Helicobacter pylori Herpesvirus 5 Borrelia Cryptococcus neoformans BLAST
    RABEP1 BLAST
    SLC4A3Human immunodeficiency virus Herpesvirus 6 Helicobacter pylori Herpesvirus 1 Herpesvirus 5 Borrelia Porphyromonas gingivalis Cryptococcus neoformans BLAST
    SPTAN1 Cryptococcus neoformans Herpesvirus 1 Human immunodeficiency virus Borrelia Herpesvirus 6 Herpesvirus 5 Porphyromonas gingivalis Helicobacter pylori BLAST
    S100B Cryptococcus neoformans Herpesvirus 6 Herpesvirus 1 Porphyromonas gingivalis Helicobacter pylori Borrelia Herpesvirus 5 Human immunodeficiency virus BLAST
    Thyroglobulin Helicobacter pylori Human immunodeficiency virus Porphyromonas gingivalis Borrelia Herpesvirus 6 Cryptococcus neoformans Herpesvirus 1 Herpesvirus 5 BLAST
    TG HP None DNA polymerase Uracil glycosylase Ribonucleotise reductase GSK3B 221
       

    Alzheimer

    All genes on the right have been implicated in genetic association studies

     
        19520
        Adhesion COL12A1: DSCAML1 : PCDH15 : PLXNB1 50648
        Cholesterol CEL : CYP46A1 : LRP10 : NPC1 : OSBP1 63909
        Growth Factor BDNF FGF2 NRG2 OGFR VEGFA 31688
        Homocysteine AHCYL2 FTSJD2 MLL4 SETD1B TARBP1 99564
        Immune FASLG TNF MMP16 NFATC2 TP53 32069
        Lipoprotein ABCA1 LDLR LRP1 LRP2 LRP3 LRP4 LRP5 LRP6 LRP8 LRP10 SREBF1 SORL1 42300
        Mitochondria CACNA2D2 DLST MTCH1 PLSCR3 SIRT3 TK2 TOMM40 TSPO 50709
          Monoamine AOC2 MAOA MAOB SLC22A3 VMAT2 46016
        CR1 CR1 fractalkine 171264
    Cytomegalovirus NC_006273.2 Overall Viral burden is associated with cognitive decline TG HP Alzheimer
    KIN MAPK8IP1 A2M APOE4 CH25H RELN PLAU DLD APBB2 DLST NOTCH4 TAPBPL ZNF224 GDI2 YME1L1 CST3 ZNF225 DPYSL2 COX2 CTNNA3 BDNF SLC6A4 PHYH PTPLA CDK5R2 FAM3A COX3 CR1L PDLIM1 CALHM1 DNMBP OAT C3 APBB1 SORCS3 SHISA4 DHCR24 HMGCR GAB2 APBA1 APBB3 BTPF(Falz) LRRTM3 NCSTN CR1 APOE COL25A1 PCDH11X TF CLU MICB IFIT5 MAPK10 ND1 CALHM2 GOLM1 TET1 SORCS1 APPBA2 TFCP2 NQO1 CELF5 MAPT GAPDH CACMB2 SLC17A5 SNCA CHRM1 ENTPD2 RALGPS2 ITM2B FKBP1A BACE2 APP BACE1 HMOX1 CHAT NCAPD2 BIN1 CHRNA4 PZP TDGF1 DKK1 ECE1 ND2 NADH4L IDE PICALM LRP1 LRP8 GSK3B UCHL1 UBQLN1 SORL1 COPS8 C4B ND3 PRNP SMPD1 ND4 OLR1 TOMM40 PEN2 S100B NMNAT3 PSEN2 MAP2 PSEN1 ALPL1 CX3CL1 ND6 BTVD16 CTSD CALHM3 SERPINA3 KIF20B BLMH ATP8 ITMA2 SERPINI1
    20270
    CR1 lipoprotein yyy
    HHV-6 Found in the Alzheimer's disease brain     Alzheimer   22405
        yyy
    Rhinovirus 14 NC_001490.1 None found TG HP

    Alzheimer

    All genes on the right have been implicated in genetic association studies

    ND3 CACNB2 KIF20B APBA1 DLST SNCA CH25H ECE1 BPTF(fALZ) APP TF CDK5R1 PSEN2 APBB2 SORCS3 BIN1 TAPBPL CLU GOLM1 FKBP1A FAM3A YME1L1 NOTCH4 TET1 BLMH DPYSL2 GAB2 LRP8 SMNDC1 LRP1 SHISA4 APLP1 SERPINA3 ND2 TFCP2 UBQLN1 MAZ LRRTM3 RALGPS2 IL1A NCSTN PEN2 PLAU CYTB PTPLA ITM2B DLD BDNF GDI2 APOE4 ITMA2 ZNF225 GAPDH SGPL1 PZP SERPINI1 OLR1 CALHM1 ND4 ATP6 HMGCR PSEN1 IFIT5 PICALM MAPK8IP1 ND4L ATP8 APBB1 MICB SORCS1 PHYH COL25A1 CHAT NCAPD2 ND6 SMPD1 IDE APBB3 FAM113B OAT NQO1 S100B ND5 CTNNA3 HMOX1 RELN BACE2 GSK3B COX2 SLC6A4 CLSTN1 PCDH11X MAPK10 PRNP MAPT CELF5 COX3 NMNAT3 BACE1 PDLIM1 ALDH18A1 CTSD ND1 APOE SORL1 UCHL1 ZNF224 DHCR24

    7862
    CR1 lipoprotein   yyy
    HIV-1 NC_001802.1 Causes dementia with Alzheimer's disease pathology TG HP Alzheimer CLU SLC17A5 S100B FKBP1A SLC6A4 CTSD HMGCR YME1L1 BACE2 CHRM1 DKK1 CX3CL1 KIN GAB2 CHAT TAPBPL ND2 TDGF1 PRNP TFCP2 CH25H PHYH NOTCH4 UCHL1 CST3 APBA1 APBB2 APPBA2 DLST TET1 CTNNA3 COL25A1 CHRNA4 C4B PZP COX3 SORCS1 ENTPD2 SMPD1 BTPF(Falz) SERPINA3 COPS8 MAPK8IP1 BDNF RALGPS2 NMNAT3 OAT CDK5R2 SNCA PICALM APOE APP SERPINI1 SORCS3 ECE1 SHISA4 IFIT5 SORL1 GAPDH ITM2B ATP8 NQO1 A2M NCSTN PSEN1 TOMM40 CALHM3 PSEN2 C3 KIF20B GDI2 PCDH11X APBB3 CALHM1 IDE PEN2 APBB1 NADH4L COX2 RELN GOLM1 HMOX1 FAM3A GSK3B ND1 APOE4 UBQLN1 DHCR24 ND6 TF ND4 ZNF225 LRP8 ITMA2 MAPK10 MAPT PTPLA DNMBP DPYSL2 CELF5 CR1 NCAPD2 BACE1 LRRTM3 ALPL1 ND3 CACMB2 PDLIM1 CALHM2 PLAU MICB MAP2 CR1L OLR1 BLMH DLD LRP1 BIN1 ZNF224 BTVD16

    9921
     
     
        CR1 lipoprotein   yyy
    Chlamydophila pneumoniae NC_005043.1 Found in in Alzheimer's disease brain and produces beta-amyloid deposition in mice TG HP Alzheimer
    APP APBB2 COX3 COPS8 NADH4L LRRTM3 APBB1 APBA1 BACE1 GDI2 PEN2 DKK1 SLC17A5 DLST NCAPD2 BACE2 GSK3B ALPL1 NMNAT3 CTSD CR1L CACMB2 CHAT ZNF225 ITMA2 LRP8 GAPDH ZNF224 SHISA4 TET1 GOLM1 PZP APPBA2 CDK5R2 FAM3A CALHM1 DLD PTPLA SORCS1 DPYSL2 SERPINA3 DNMBP PRNP CLU CALHM2 MAPK10 GAB2 ENTPD2 SORCS3 A2M NQO1 SMPD1 S100B ECE1 ATP8 RALGPS2 PICALM TDGF1 CR1 TF PDLIM1 KIF20B FKBP1A KIN SORL1 BTPF(Falz) LRP1 CELF5 HMGCR TOMM40 ND3 CALHM3 CX3CL1 PHYH APOE COX2 BLMH DHCR24 UBQLN1 NOTCH4 COL25A1 PSEN1 BTVD16 TFCP2 CST3 IDE RELN SERPINI1 OLR1 MICB PSEN2 UCHL1 APOE4 BDNF BIN1 NCSTN CH25H HMOX1 CTNNA3 SNCA ITM2B MAPK8IP1 APBB3 TAPBPL PLAU SLC6A4 IFIT5 MAPT
    17132
    CR1 lipoprotein Redo
    Borrelia Burgdorferii NC_011728.1 Found in amyloid plaques in Alzheimer's disease and produces beta-amyloid deposition in mice TG HP Alzheimer
    ECE1 BACE1 BIN1 PHYH DLD COL25A1 GAB2 KIN DKK1 HMOX1 CH25H CR1 PDLIM1 NADH4L FAM3A SHISA4 TDGF1 ITMA2 ND1 NQO1 RALGPS2 BDNF ND5 CTNNA3 RELN BACE2 PICALM PRNP CST3 MICB PLAU COPS8 ZNF225 CX3CL1 C3 CALHM2 MAPK10 APBB2 TAPBPL APOE SORCS3 CELF5 PEN2 DPYSL2 APLP1 CACNB2 DHCR24 ZNF224 CR1L DNMBP GDI2 DOCK3 BLMH SMPD1 MAPT GOLM1 PTPLA NCAPD2 IFIT5 MAP2 NOTCH4 COX3 TFCP2 ATP8 SORL1 APBB3 SERPINI1 TF IL1A PCDH11X MAPK8IP1 SERPINA3 SNCA LRP1 NCSTN CALHM3 SORCS1 ITM2B ND3 APBA1 NMNAT3 BTBD16 PZP UBQLN1 ND6 COX2 ENTPD2 CLU KIF20B SLC17A5 GSK3B CALHM1 ND4 CHAT PSEN1 APP LRRTM3 CTSD SLC6A4 UCHL1 IDE LRP8 A2M GAPDH TOMM40 CDK5R2 APOE4 TET1 S100B FKBP1A APBB1 APPBA2 HMGCR OLR1
    14822
    CR1 lipoprotein 225900
    Helicobacter pylori NC_014256.1 Eradication ameliorates cognitive function TG   Alzheimer
    CALHM3 S100B TFCP2 APPBA2 CHAT KIF20B APBB3 BACE1 ITMA2 SLC6A4 HMOX1 KIN CTNNA3 FKBP1A RALGPS2 PDLIM1 A2M SHISA4 CELF5 CACMB2 APOE GOLM1 RELN GDI2 APP TET1 MAPK10 HMGCR APOE4 PLAU PSEN2 NMNAT3 DPYSL2 COL25A1 SERPINA3 SORCS3 LRP8 CH25H IDE ECE1 ND3 MAPK8IP1 NCAPD2 COX2 SLC17A5 NOTCH4 COX3 NADH4L LRP1 SERPINI1 DLST CST3 BACE2 GSK3B APBB1 CALHM1 CALHM2 GAPDH CR1 OLR1 BIN1 BTVD16 ITM2B SMPD1 DNMBP DLD APBB2 MAPT ALPL1 TF PZP PSEN1 SNCA TAPBPL FAM3A PHYH CLU PTPLA GAB2 PRNP BDNF PEN2 TOMM40 SORCS1 DHCR24 IFIT5 MICB APBA1 SORL1 NQO1 DKK1 UCHL1 ZNF225 ZNF224 COPS8 PICALM LRRTM3 CDK5R2 UBQLN1 CTSD BLMH NCSTN ATP8
    18082
    CR1 lipoprotein yyy
    Porphyromonas gingivalis ATCC 33277 NC_010729.1 Tooth loss and poor dental health associated with Alzheimer's disease TG   Alzheimer
    PDLIM1 PEN2 NMNAT3 SERPINA3 IFIT5 BIN1 BACE2 A2M ZNF225 DNMBP TF CDK5R2 CALHM1 GAB2 SORL1 CHRNA4 COX3 NCSTN ITMA2 DKK1 COL25A1 LRP8 PTPLA HMOX1 CALHM2 KIF20B GSK3B MAPT CST3 PCDH11X PRNP S100B TFCP2 ND4 APOE4 SORCS3 COPS8 TOMM40 C4B ECE1 IDE NQO1 CLU DLST RALGPS2 APBB1 APPBA2 SMPD1 APBB3 APOE APBB2 BLMH BDNF SLC17A5 DHCR24 UCHL1 BACE1 ND6 CH25H SLC6A4 ALPL1 NADH4L APP BTVD16 ND2 PHYH ITM2B CACMB2 NCAPD2 PICALM MICB CELF5 BTPF(Falz) FKBP1A CR1 SORCS1 COX2 PSEN1 SERPINI1 MAPK10 FAM3A CX3CL1 LRRTM3 HMGCR PZP NOTCH4 CR1L GDI2 ZNF224 CALHM3 GOLM1 SHISA4 ATP8 APBA1 DPYSL2 TET1 CTNNA3 GAPDH DLD CHAT CTSD OLR1 MAPK8IP1 RELN ENTPD2 TAPBPL KIN SNCA LRP1 ND3 PSEN2 ND1 PLAU TDGF1 UBQLN1
    17561
    CR1 lipoprotein   19479
    C.Neoformans C.Neoformans eradication cured Alzheimer's disease in 2 case reports       Chromosomes are duplicated in C.Neoformans accounting for the similarity below  
    • Chromosome 1
      TG   Alzheimer CHAT PLAU MAPK10 RALGPS2 NCAPD2 LRP8 DNMBP CDK5R2 S100B NMNAT3 TFCP2 APBB3 APPBA2 SLC6A4 NOTCH4 GAB2 CALHM3 APOE SORCS3 BDNF PZP COL25A1 MAP2 APBB1 SORL1 CR1L FAM3A APBA1 SNCA ITMA2 COX3 PRNP HMOX1 ITM2B SERPINA3 IFIT5 CTNNA3 CST3 BIN1 ATP8 MICB ZNF225 TF TDGF1 UCHL1 NCSTN ND1 HMGCR ND3 KIF20B DKK1 COX2 ECE1 ND6 ND5 C3 CLU PTPLA CALHM1 NADH4L GSK3B SHISA4 CH25H KIN CTSD CR1 OLR1 SERPINI1 A2M GAPDH ZNF224 APOE4 DHCR24 PDLIM1 CALHM2 RELN DLD BTBD16 TAPBPL CX3CL1 LRP1 APP PHYH ND4 MAPK8IP1 GDI2 DPYSL2 IL1A LRRTM3 FKBP1A UBQLN1 DOCK3 NQO1 PEN2 PSEN1 SLC17A5 CACNB2 SORCS1 APLP1 SMPD1 APBB2 TOMM40 TET1 COPS8 BLMH MAPT PCDH11X IDE BACE2 CELF5 GOLM1 PICALM BACE1 ENTPD2

    16474
    CR1 lipoprotein yyy
    • 2
      TG   Alzheimer 103 Alzheimer's disease susceptibility genes hits to C.Neo.II. CR1 APP APPBA2 BIN1 MAPT PSEN2 BACE1 PSEN1 BDNF APBB2 APBB3 CLU COL25A1 COX2 ECE1 LRP8 ND3 APBB1 NQO1 BACE2 CHAT COX3 NADH4L OLR1 SNCA TFCP2 ATP8 CACNB2 COPS8 DLD GAB2 GDI2 GSK3B IDE LRP1 PHYH PLAU RELN S100B SORCS1 SORL1 TF UBQLN1 C4B CST3 A2M APBA1 APLP1 APOE BTBD16 CALHM1 CALHM2 CALHM3 CDK5R2 CELF5 CH25H CTNNA3 CTSD DHCR24 DKK1 DLST DNMBP DPYSL2 FAM3A FKBP1A GAPDH GOLM1 HMGCR HMOX1 IFIT5 IL1A ITM2B ITMA2 KIF20B KIN LRRTM3 MAPK10 MAPK8IP1 MICB NCAPD2 NCSTN NMNAT3 NOTCH4 PDLIM1 PEN2 PICALM PRNP PTPLA PZP RALGPS2 SERPINA3 SERPINI1 SHISA4 SLC17A5 SLC6A4 SMPD1 SORCS3 TAPBPL TET1 TOMM40 UCHL1 ZNF224 ZNF225 BLMH 16396
    CR1 lipoprotein 329613
    • 3
      TG   Alzheimer

    104 Alzheimer's disease susceptibility genes hits to C.Neo.III CR1 APP APPBA2 BIN1 MAPT PSEN2 BACE1 PSEN1 BDNF APBB2 APBB3 CLU COL25A1 COX2 ECE1 LRP8 ND3 APBB1 NQO1 BACE2 CHAT COX3 NADH4L OLR1 SNCA TFCP2 ATP8 CACNB2 COPS8 DLD GAB2 GDI2 GSK3B IDE LRP1 PHYH PLAU RELN S100B SORCS1 SORL1 TF UBQLN1 C4B CST3 A2M APBA1 APLP1 APOE BTBD16 CALHM1 CALHM2 CALHM3 CDK5R2 CELF5 CH25H CTNNA3 CTSD DHCR24 DKK1 DLST DNMBP DPYSL2 FAM3A FKBP1A GAPDH GOLM1 HMGCR HMOX1 IFIT5 IL1A ITM2B ITMA2 KIF20B KIN LRRTM3 MAPK10 MAPK8IP1 MICB NCAPD2 NCSTN NMNAT3 NOTCH4 PDLIM1 PEN2 PICALM PRNP PTPLA PZP RALGPS2 SERPINA3 SERPINI1 SHISA4 SLC17A5 SLC6A4 SMPD1 SORCS3 TAPBPL TET1 TOMM40 UCHL1 ZNF224 ZNF225 BLMH

    16932
    CR1 lipoprotein 374183
    • 4
      TG   Alzheimer 104 Alzheimer's disease susceptibility genes hits to C.Neo IV CR1 APP APPBA2 BIN1 MAPT PSEN2 BACE1 PSEN1 BDNF APBB2 APBB3 CLU COL25A1 COX2 ECE1 LRP8 ND3 APBB1 NQO1 BACE2 CHAT COX3 NADH4L OLR1 SNCA TFCP2 ATP8 CACNB2 COPS8 DLD GAB2 GDI2 GSK3B IDE LRP1 PHYH PLAU RELN S100B SORCS1 SORL1 TF UBQLN1 C4B CST3 A2M APBA1 APLP1 APOE BTBD16 CALHM1 CALHM2 CALHM3 CDK5R2 CELF5 CH25H CTNNA3 CTSD DHCR24 DKK1 DLST DNMBP DPYSL2 FAM3A FKBP1A GAPDH GOLM1 HMGCR HMOX1 IFIT5 IL1A ITM2B ITMA2 KIF20B KIN LRRTM3 MAPK10 MAPK8IP1 MICB NCAPD2 NCSTN NMNAT3 NOTCH4 PDLIM1 PEN2 PICALM PRNP PTPLA PZP RALGPS2 SERPINA3 SERPINI1 SHISA4 SLC17A5 SLC6A4 SMPD1 SORCS3 TAPBPL TET1 TOMM40 UCHL1 ZNF224 ZNF225 BLMH 14771
    CR1 lipoprotein 323537
    • 5
      TG   Alzheimer 105 Alzheimer's disease susceptibility genes hits to C.Neo V CR1 APP APPBA2 BIN1 MAPT PSEN2 BACE1 PSEN1 BDNF APBB2 APBB3 CLU COL25A1 COX2 ECE1 LRP8 ND3 APBB1 NQO1 BACE2 CHAT COX3 NADH4L OLR1 SNCA TFCP2 ATP8 CACNB2 COPS8 DLD GAB2 GDI2 GSK3B IDE LRP1 PHYH PLAU RELN S100B SORCS1 SORL1 TF UBQLN1 C4B CST3 A2M APBA1 APLP1 APOE BLMH BTBD16 CALHM1 CALHM2 CALHM3 CBARA1 CDK5R2 CELF5 CTNNA3 CTSD DHCR24 DKK1 DLST DNMBP DPYSL2 FAM3A FKBP1A GAPDH GOLM1 HMGCR HMOX1 IFIT5 IL1A ITM2B ITMA2 KIF20B KIN LRRTM3 MAPK10 MAPK8IP1 MICB NCAPD2 NCSTN NMNAT3 NOTCH4 PDLIM1 PEN2 PICALM PRNP PTPLA PZP RALGPS2 SERPINA3 SERPINI1 SHISA4 SLC17A5 SLC6A4 SMPD1 SORCS3 TAPBPL TET1 TOMM40 UCHL1 ZNF224 ZNF225 C2H25H MARK1 21216
    CR1 lipoprotein 313741
    • 6
      TG   Alzheimer 103 Alzheimer's disease susceptibility genes hits to C.Neo VI CR1 APP APPBA2 BIN1 MAPT PSEN2 BACE1 PSEN1 BDNF APBB2 APBB3 CLU COL25A1 COX2 ECE1 LRP8 ND3 APBB1 NQO1 BACE2 CHAT COX3 NADH4L OLR1 SNCA TFCP2 ATP8 CACNB2 COPS8 DLD GAB2 GDI2 GSK3B IDE LRP1 PHYH PLAU RELN S100B SORCS1 SORL1 TF UBQLN1 C4B CST3 A2M APBA1 APLP1 APOE BTBD16 CALHM1 CALHM2 CALHM3 CDK5R2 CELF5 CH25H CTNNA3 CTSD DHCR24 DKK1 DLST DNMBP DPYSL2 FAM3A FKBP1A GAPDH GOLM1 HMGCR HMOX1 IFIT5 IL1A ITM2B ITMA2 KIF20B KIN LRRTM3 MAPK10 MAPK8IP1 MICB NCAPD2 NCSTN NMNAT3 NOTCH4 PDLIM1 PEN2 PICALM PRNP PTPLA PZP RALGPS2 SERPINA3 SERPINI1 SHISA4 SLC17A5 SLC6A4 SMPD1 SORCS3 TAPBPL TET1 TOMM40 UCHL1 ZNF224 ZNF225 BLMH 20842
    CR1 lipoprotein 305638
    • 7
      TG   Alzheimer 103 Alzheimer's disease susceptibility genes hits to C.Neo VII CR1 APP APPBA2 BIN1 MAPT PSEN2 BACE1 PSEN1 BDNF APBB2 APBB3 CLU COL25A1 COX2 ECE1 LRP8 ND3 APBB1 NQO1 BACE2 CHAT COX3 NADH4L OLR1 SNCA TFCP2 ATP8 CACNB2 COPS8 DLD GAB2 GDI2 GSK3B IDE LRP1 PHYH PLAU RELN S100B SORCS1 SORL1 TF UBQLN1 C4B CST3 A2M APBA1 APLP1 APOE BTBD16 CALHM1 CALHM2 CALHM3 CDK5R2 CELF5 CH25H CTNNA3 CTSD DHCR24 DKK1 DLST DNMBP DPYSL2 FAM3A FKBP1A GAPDH GOLM1 HMGCR HMOX1 IFIT5 IL1A ITM2B ITMA2 KIF20B KIN LRRTM3 MAPK10 MAPK8IP1 MICB NCAPD2 NCSTN NMNAT3 NOTCH4 PDLIM1 PEN2 PICALM PRNP PTPLA PZP RALGPS2 SERPINA3 SERPINI1 SHISA4 SLC17A5 SLC6A4 SMPD1 SORCS3 TAPBPL TET1 TOMM40 UCHL1 ZNF224 ZNF225 BLMH 15394
    CR1 lipoprotein 293601
    • 8
      TG   Alzheimer

    103 Alzheimer's disease susceptibility genes hits to C.Neo VIII CR1 APP APPBA2 BIN1 MAPT PSEN2 BACE1 PSEN1 BDNF APBB2 APBB3 CLU COL25A1 COX2 ECE1 LRP8 ND3 APBB1 NQO1 BACE2 CHAT COX3 NADH4L OLR1 SNCA TFCP2 ATP8 CACNB2 COPS8 DLD GAB2 GDI2 GSK3B IDE LRP1 PHYH PLAU RELN S100B SORCS1 SORL1 TF UBQLN1 C4B CST3 A2M APBA1 APLP1 APOE BTBD16 CALHM1 CALHM2 CALHM3 CDK5R2 CELF5 CH25H CTNNA3 CTSD DHCR24 DKK1 DLST DNMBP DPYSL2 FAM3A FKBP1A GAPDH GOLM1 HMGCR HMOX1 IFIT5 IL1A ITM2B ITMA2 KIF20B KIN LRRTM3 MAPK10 MAPK8IP1 MICB NCAPD2 NCSTN NMNAT3 NOTCH4 PDLIM1 PEN2 PICALM PRNP PTPLA PZP RALGPS2 SERPINA3 SERPINI1 SHISA4 SLC17A5 SLC6A4 SMPD1 SORCS3 TAPBPL TET1 TOMM40 UCHL1 ZNF224 ZNF225 BLMH

    15988
    CR1 lipoprotein 292701
    • 9
      TG   Alzheimer 103 Alzheimer's disease susceptibility genes hits to C.Neo IX CR1 APP APPBA2 BIN1 MAPT PSEN2 BACE1 PSEN1 BDNF APBB2 APBB3 CLU COL25A1 COX2 ECE1 LRP8 ND3 APBB1 NQO1 BACE2 CHAT COX3 NADH4L OLR1 SNCA TFCP2 ATP8 CACNB2 COPS8 DLD GAB2 GDI2 GSK3B IDE LRP1 PHYH PLAU RELN S100B SORCS1 SORL1 TF UBQLN1 C4B CST3 A2M APBA1 APLP1 APOE BTBD16 CALHM1 CALHM2 CALHM3 CDK5R2 CELF5 CH25H CTNNA3 CTSD DHCR24 DKK1 DLST DNMBP DPYSL2 FAM3A FKBP1A GAPDH GOLM1 HMGCR HMOX1 IFIT5 IL1A ITM2B ITMA2 KIF20B KIN LRRTM3 MAPK10 MAPK8IP1 MICB NCAPD2 NCSTN NMNAT3 NOTCH4 PDLIM1 PEN2 PICALM PRNP PTPLA PZP RALGPS2 SERPINA3 SERPINI1 SHISA4 SLC17A5 SLC6A4 SMPD1 SORCS3 TAPBPL TET1 TOMM40 UCHL1 ZNF224 ZNF225 BLMH 21813
    CR1 lipoprotein 289976
    • 10
      TG   Alzheimer

    103 Alzheimer's disease susceptibility genes hits to C.Neo X

    CR1 APP APPBA2 BIN1 MAPT PSEN2 BACE1 PSEN1 BDNF APBB2 APBB3 CLU COL25A1 COX2 ECE1 LRP8 ND3 APBB1 NQO1 BACE2 CHAT COX3 NADH4L OLR1 SNCA TFCP2 ATP8 CACNB2 COPS8 DLD GAB2 GDI2 GSK3B IDE LRP1 PHYH PLAU RELN S100B SORCS1 SORL1 TF UBQLN1 C4B CST3 A2M APBA1 APLP1 APOE BTBD16 CALHM1 CALHM2 CALHM3 CDK5R2 CELF5 CH25H CTNNA3 CTSD DHCR24 DKK1 DLST DNMBP DPYSL2 FAM3A FKBP1A GAPDH GOLM1 HMGCR HMOX1 IFIT5 IL1A ITM2B ITMA2 KIF20B KIN LRRTM3 MAPK10 MAPK8IP1 MICB NCAPD2 NCSTN NMNAT3 NOTCH4 PDLIM1 PEN2 PICALM PRNP PTPLA PZP RALGPS2 SERPINA3 SERPINI1 SHISA4 SLC17A5 SLC6A4 SMPD1 SORCS3 TAPBPL TET1 TOMM40 UCHL1 ZNF224 ZNF225 BLMH

    20297
    CR1 lipoprotein 275497
    • 11
      TG   Alzheimer 103 Alzheimer's disease susceptibility genes hits to C.Neo XI CR1 APP APPBA2 BIN1 MAPT PSEN2 BACE1 PSEN1 BDNF APBB2 APBB3 CLU COL25A1 COX2 ECE1 LRP8 ND3 APBB1 NQO1 BACE2 CHAT COX3 NADH4L OLR1 SNCA TFCP2 ATP8 CACNB2 COPS8 DLD GAB2 GDI2 GSK3B IDE LRP1 PHYH PLAU RELN S100B SORCS1 SORL1 TF UBQLN1 C4B CST3 A2M APBA1 APLP1 APOE BTBD16 CALHM1 CALHM2 CALHM3 CDK5R2 CELF5 CH25H CTNNA3 CTSD DHCR24 DKK1 DLST DNMBP DPYSL2 FAM3A FKBP1A GAPDH GOLM1 HMGCR HMOX1 IFIT5 IL1A ITM2B ITMA2 KIF20B KIN LRRTM3 MAPK10 MAPK8IP1 MICB NCAPD2 NCSTN NMNAT3 NOTCH4 PDLIM1 PEN2 PICALM PRNP PTPLA PZP RALGPS2 SERPINA3 SERPINI1 SHISA4 SLC17A5 SLC6A4 SMPD1 SORCS3 TAPBPL TET1 TOMM40 UCHL1 ZNF224 ZNF225 BLMH 15278
    CR1 lipoprotein 262729
    • 12
      TG   Alzheimer 103 Alzheimer's disease susceptibility genes hits to C.Neo XII CR1 APP APPBA2 BIN1 MAPT PSEN2 BACE1 PSEN1 BDNF APBB2 APBB3 CLU COL25A1 COX2 ECE1 LRP8 ND3 APBB1 NQO1 BACE2 CHAT COX3 NADH4L OLR1 SNCA TFCP2 ATP8 CACNB2 COPS8 DLD GAB2 GDI2 GSK3B IDE LRP1 PHYH PLAU RELN S100B SORCS1 SORL1 TF UBQLN1 C4B CST3 A2M APBA1 APLP1 APOE BTBD16 CALHM1 CALHM2 CALHM3 CDK5R2 CELF5 CH25H CTNNA3 CTSD DHCR24 DKK1 DLST DNMBP DPYSL2 FAM3A FKBP1A GAPDH GOLM1 HMGCR HMOX1 IFIT5 IL1A ITM2B ITMA2 KIF20B KIN LRRTM3 MAPK10 MAPK8IP1 MICB NCAPD2 NCSTN NMNAT3 NOTCH4 PDLIM1 PEN2 PICALM PRNP PTPLA PZP RALGPS2 SERPINA3 SERPINI1 SHISA4 SLC17A5 SLC6A4 SMPD1 SORCS3 TAPBPL TET1 TOMM40 UCHL1 ZNF224 ZNF225 BLMH 12842
    CR1 lipoprotein 273108
    • 13
      TG   Alzheimer 103 Alzheimer's disease susceptibility genes hits to C.Neo XIII CR1 APP APPBA2 BIN1 MAPT PSEN2 BACE1 PSEN1 BDNF APBB2 APBB3 CLU COL25A1 COX2 ECE1 LRP8 ND3 APBB1 NQO1 BACE2 CHAT COX3 NADH4L OLR1 SNCA TFCP2 ATP8 CACNB2 COPS8 DLD GAB2 GDI2 GSK3B IDE LRP1 PHYH PLAU RELN S100B SORCS1 SORL1 TF UBQLN1 C4B CST3 A2M APBA1 APLP1 APOE BTBD16 CALHM1 CALHM2 CALHM3 CDK5R2 CELF5 CH25H CTNNA3 CTSD DHCR24 DKK1 DLST DNMBP DPYSL2 FAM3A FKBP1A GAPDH GOLM1 HMGCR HMOX1 IFIT5 IL1A ITM2B ITMA2 KIF20B KIN LRRTM3 MAPK10 MAPK8IP1 MICB NCAPD2 NCSTN NMNAT3 NOTCH4 PDLIM1 PEN2 PICALM PRNP PTPLA PZP RALGPS2 SERPINA3 SERPINI1 SHISA4 SLC17A5 SLC6A4 SMPD1 SORCS3 TAPBPL TET1 TOMM40 UCHL1 ZNF224 ZNF225 BLMH 13997
    CR1 lipoprotein 249037
    • 14
      TG   Alzheimer

    103 Alzheimer's disease susceptibility genes hits to C.Neo XIV

    CR1 APP APPBA2 BIN1 MAPT PSEN2 BACE1 PSEN1 BDNF APBB2 APBB3 CLU COL25A1 COX2 ECE1 LRP8 ND3 APBB1 NQO1 BACE2 CHAT COX3 NADH4L OLR1 SNCA TFCP2 ATP8 CACNB2 COPS8 DLD GAB2 GDI2 GSK3B IDE LRP1 PHYH PLAU RELN S100B SORCS1 SORL1 TF UBQLN1 C4B CST3 A2M APBA1 APLP1 APOE BTBD16 CALHM1 CALHM2 CALHM3 CDK5R2 CELF5 CH25H CTNNA3 CTSD DHCR24 DKK1 DLST DNMBP DPYSL2 FAM3A FKBP1A GAPDH GOLM1 HMGCR HMOX1 IFIT5 IL1A ITM2B ITMA2 KIF20B KIN LRRTM3 MAPK10 MAPK8IP1 MICB NCAPD2 NCSTN NMNAT3 NOTCH4 PDLIM1 PEN2 PICALM PRNP PTPLA PZP RALGPS2 SERPINA3 SERPINI1 SHISA4 SLC17A5 SLC6A4 SMPD1 SORCS3 TAPBPL TET1 TOMM40 UCHL1 ZNF224 ZNF225 BLMH

    14793
    CR1 lipoprotein 244187
    APOE 4     VP None
    Burkholderia phage Adeno-associated virus Spodoptera frugiperda ascovirus Human herpesvirus 3 Norovirus shrimp white spot syndrome virus Staphylococcus phage Caretta caretta papillomavirus Klebsiella phage Budgerigar fledgling disease polyomavirus Mycobacterium phage Gumball Mycobacterium phage Pumpkin Bacopa chlorosis virus Mammalian orthoreovirus Neodiprion abietis NPV Enterobacteria phage Blueberry scorch virus Rabbit vesivirus] Lymphocytic choriomeningitis virus Cowpox virus Equid herpesvirus 1 Turnip mosaic virus Seoul virus Shigella phage Trichomonas vaginalis virus Fiji disease virus Triticum mosaic virus Wheat streak mosaic virus Measles virusLactococcus phage Paenibacillus phage Apple mosaic virus Enterobacteria phage Narcissus degeneration virus Campoletis sonorensis ichnovirus Hepatitis B Human herpesvirus 6 Ranid herpesvirus 1 African green monkey polyomavirus White lupin mosaic virus Rhodococcus phage Visna/Maedi virus Bacillus phage Pseudomonas phage Satsuma dwarf virus Murine coronavirus Human herpesvirus 6B Sulfolobus virus Rice tungro spherical virus Walrus calicivirus Raspberry ringspot virus Porcine torovirus Alcelaphine herpesvirus 1 Porcine endogenous retrovirus Puumala virus Crocodilepox virus Ovine papillomavirus Synechococcus phage Emiliania huxleyi virus Bovine herpesvirus 5 Steller sea lion vesivirus Barley yellow dwarf virus uncultured Myoviridae Mycobacterium phage Peaches Bat astrovirus Streptococcus pyogenes phage gorilla cytomegalovirus Flexal virus Gallid herpesvirus TTV-like mini virus Human herpesvirus 4 Torque teno virus Small ruminant lentivirus Duck enteritis virus Johnston Atoll virus Stenotrophomonas phage Simian retrovirus Soochong virus Acidianus bottle-shaped virus Fowl adenovirus orf virus Mycobacterium phage Porky Orgyia pseudotsugata MNPV Rhizobium phage Paramecium bursaria Chlorella virus Pseudomonas phage Adoxophyes orana nucleopolyhedrovirus Heliothis virescens ascovirus Hantaan virus Rice gall dwarf virus Apple chlorotic leaf spot virus Pea seed-borne mosaic virus Sapovirus swine Pirital virus Hantavirus Bluetongue virus Clostridium phage Cydia pomonella granulovirus Vaccinia virus Chrysanthemum virus Acyrthosiphon pisum bacteriophage Variola virus Listonella phage Horsepox virus Clavibacter phage Rubella Epizootic hemorrhagic disease virus Cao Bang virus Iodobacteriophage Streptococcus phage Aedes flavivirus Influenza B virus Sulfolobus islandicus filamentous virus Nariva virus] Geobacillus virus Pan troglodytes cytomegalovirus Vibrio phage Corynebacterium phage Lassa virus Bovine torovirus Helicobasidium mompa mitovirus Bovine viral diarrhea virus Acanthocystis turfacea Chlorella virus Prochlorococcus phage Human herpesvirus 7 Mycoplasma phage European bat lyssavirus Tobacco streak virus Hepatitis C Rotavirus Mastomys coucha papillomavirus Human immunodeficiency virus 1 Human immunodeficiency virus 2
    127
    APOE 4   Vir P None

    102 No HIV

     

    107 with HIV

    APOE 4   Bact P      
    APOE 4   Yeast P  
    Candida glabrata Scheffersomyces stipitis Saccharomyces cerevisiae Pichia pastoris SClavispora lusitaniae Candida albicans Lodderomyces elongisporus Zygosaccharomyces rouxii Candida dubliniensis Candida glabrata Meyerozyma guilliermondii Candida tropicalis Ashbya gossypii Yarrowia lipolytica Debaryomyces hansenii Saccharomyces bayanus Kluyveromyces lactis Lachancea thermotolerans Lachancea kluyveri Vanderwaltozyma polyspora Eremothecium gossypii Pichia guilliermondii Naumovia castellii
    173
        Fungi P  
    Coccidioides posadasii Pyrenophora Sclerotinia sclerotiorum Schizosaccharomyces japonicus Ajellomyces capsulatus Penicillium marneffei Postia placenta Malassezia globosa Aspergillus terreus Chaetomium globosum Podospora anserina Arthroderma benhamiae Meyerozyma guilliermondii Coccidioides immitis Talaromyces stipitatus Penicillium chrysogenum Cryptococcus neoformans Podospora anserina Aspergillus clavatus Ashbya gossypii Phaeosphaeria nodorum Pyrenophora tritici-repentis Penicillium marneffei Laccaria bicolor Paracoccidioides brasiliensis Aspergillus oryzae Trichophyton verrucosum Saccharomyces cerevisiae Schizophyllum Botryotinia fuckeliana Aspergillus nidulans Arthroderma otae Gibberella zeae Nectria haematococca Zygosaccharomyces rouxii Neosartorya fischeri Yarrowia lipolytica Magnaporthe oryzae Neosartorya fischeri Pichia pastoris Neurospora crassa Debaryomyces hansenii Vanderwaltozyma polyspor Coprinopsis cinerea Talaromyces stipitatus Chaetomium globosum Aspergillus fumigatus Clavispora lusitaniae Schizosaccharomyces pombe] Aspergillus nidulans Magnaporthe oryzae Ustilago maydis Ajellomyces capsulatus Kluyveromyces lactis Scheffersomyces stipitis Nectria haematococca Candida albicans Candida tropicalis Verticillium albo-atrum Candida dubliniensis Tuber melanosporum Aspergillus flavus Ajellomyces dermatitidis Encephalitozoon intestinalis Uncinocarpus reesii
    131 BLAST
    APOE 4   Rhinovirus     586
    APOE 4   HIV1     884
    APOE 4   Allergen   Allergen 508
    APOE 4   None    
    Beta amyloid   VGGVV VP   69 Phages and viruses with 100% identity
    APP   Beta amyloid 1-42 VP   385 viral and phage hits
    APP mutants The localisation of the APP 717 and swedish mutations, in red, and of the beta- and gamma-secretase (ß and γ) cleavage sites . The beta-amyloid sequence is in blue. The peptides used for homology searches are underlined
    • ...LTNIKTEEISEVKMßDAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVγIATVIVITLVMγLKKK
    • Swedish .....EISEVNL
    • 717 mutants.........................................................................................................................V>F: V>G: V>I: V>L AD and FTD mutation database
     
    APP   V717 VP     122
      V717 BP     111
      F717 VP     BLAST
      F717 BP     111
      G17 BP     108
      G17 VP     BLAST132
      I717 BP     102
      I717 VP Phages of commensal bacteria or common viruses in red.
    Raspberry ringspot virus Adoxophyes orana nucleopolyhedrovirus Adoxophyes honmai NPV Plutella xylostella granulovirus Acanthocystis turfacea Chlorella virus Aeromonas phage Panine herpesvirus 2 Spodoptera frugiperda ascovirus Ecotropis obliqua NPV Yaba-like disease virus Acanthocystis turfacea Chlorella virus Mycobacterium phage Bombyx mandarina nucleopolyhedrovirus Rice grassy stunt virus Alcelaphine herpesvirus Maize chlorotic dwarf virus Murine norovirus Sulfolobus virus Listeria phage Emiliania huxleyi virus His2 virus Taterapox virus Verbena virus Y Tanapox virus Bacillus phage Gallid herpesvirus 2 Lymphocystis disease virus Swinepox virus Meleagrid herpesvirus Pseudaletia unipuncta granulovirus Cryptophlebia leucotreta granulovirus Helicoverpa zea SNPV Helicoverpa armigera multiple nucleopolyhedrovirus Culex nigripalpus NPV Bat coronavirus Choristoneura fumiferana DEF MNPV Shrimp white spot syndrome virus Bombyx mori NPV Anguillid herpesvirus 1 Macacine herpesvirus 3 Canarypox virus Sulfolobus spindle-shaped virus Human coronavirus Enterobacteria phage Glossina pallidipes salivary gland hypertrophy virus Pieris rapae granulovirus Thermus phage Hendra virus Oryctes rhinoceros virus Sacbrood virus Transmissible gastroenteritis virus Acanthamoeba polyphaga mimivirus Rabbit fibroma virus Human rhinovirus Lumpy skin disease virus Methanothermobacter phage Enzootic nasal tumour virus of goats Ectocarpus siliculosus virus Burkholderia phage Feline coronavirus Wild tomato mosaic virus Helicoverpa armigera NPV Sandfly fever Naples virus Adoxophyes orana granulovirus Chrysodeixis chalcites nucleopolyhedrovirus Spodoptera litura nucleopolyhedrovirus Australian bat lyssavirus Methanobacterium phage Staphylococcus phage Equid herpesvirus 4 Cucumber vein yellowing virus Synechococcus phage Cydia pomonella granulovirus Paramecium bursaria Chlorella virus Ngaingan virus Human herpesvirus 2 Microplitis demolitor bracovirus Pseudomonas phage Psittacid herpesvirus Oropouche virus Spodoptera litura granulovirus Microcystis phage Sputnik virophage Mamestra configurata NPV-A Klebsiella phage Escherichia phage Listeria phage Gallid herpesvirus 1 Human enterovirus A Xylella phage Sendai virus Trichoplusia ni SNPV Daphne virus European bat lyssavirus Vibrio phage Musca domestica salivary gland hypertrophy virus Ranid herpesvirus 2 Anticarsia gemmatalis nucleopolyhedrovirus Streptococcus pyogenes phage Orgyia leucostigma NPV Lactococcus phage Human herpesvirus 6 Goatpox virus Pellor Euproctis pseudoconspersa nucleopolyhedrovirus Spodoptera exigua MNPV Lactobacillus phage Lymantria dispar MNPV Salmonella phage Salmonella phage Avian metapneumovirus Choristoneura occidentalis granulovirus Spodoptera litura nucleopolyhedrovirus Tomato yellow leaf curl Thailand virus Variola virus Amsacta moorei entomopoxvirus Usutu virus Marseillevirus Carrot yellow leaf virus Ambystoma tigrinum virus Epiphyas postvittana NPV Enterobacteria phage Fowl adenovirus D Lymantria xylina MNPV Helicoverpa armigera nucleopolyhedrovirus Beluga Whale coronavirus Natrialba phage Human herpesvirus 8 Ectromelia virus Fowlpox virus Vaccinia virus Clostridium phage Venezuelan equine encephalitis virus Ostreid herpesvirus 1 Liao ning virus Phthorimaea operculella granulovirus Deerpox virus Leucania separata nuclear polyhedrosis virus Felid herpesvirus 1 Human herpesvirus 5 Gryllus bimaculatus nudivirus Xanthomonas phage Allium virus X Human herpesvirus 7 Influenza A virus Norovirus Human coronavirus shigella phage Human parainfluenza virus Influenza B virus Pasteurella phage Human papillomavirus
    BLAST
      L717 BP      
      L717 VP      
     

    Swedish normal

    VP     112
      BP     100
      FP YP     107
     

    Swedish

    Mutant

    VP Commensal bacteria phages and common viruses in red
    Avian metapneumovirus Spodoptera litura Emiliania huxleyi norovirus clostridium phage Glossina pallidipes salivary gland hypertrophy virus Aeromonas phage Lactobacillus phage Bovine herpesvirus Staphylococcus phage Microplitis demolitor bracovirus Newcastle disease Paramecium bursaria chlorella virus Acidianus filamentous virus Listeria phage shigella phage Enterobacteria phage Norwalk Breda virus Human immunodeficiency virus
    ddd
      BP

    Commensal bacteria in red

    * links to PUBMED

    Streptomyces Vibrio Bacteroides Legionella Acinetobacter Enterococcus faecalis* Burkholderia Frankia Desulfotalea psychrophila Anaerococcus lactolyticus Lactococcus Burkholderia Coxiella Clostridium Porphyromonas gingivalis Haemophilus influenzae* Leptospira interrogans Ralstonia Fusobacterium Yersinia Rickettsia Sphingobacterium Cardiobacterium* Streptococcus Microcystis* Actinobacillus Leptospira Shigella Escherichia coli Peptostreptococcus* Shewanella* Agrobacterium Staphylococcus Leptospira Arthrospira Lactobacillus*
    100
      FP YP     ddd
    Abeta Catalytic antibody sites Taguchi et al 2008 Catalytic autoantibodies are less likely to mount a full-blown autoimmune response and will destroy beta-amyloid

    HHQKL

    VP The huge number of viruses homologous to such short stretches illustrates the magnitude of viral insertion over millions of years

    Kaposi's sarcoma virus (HSV-8) Papillomavirus and other cancer viruses (in red)

    Cancer is inversely associated with Alzheimer's disease risk

    Bat SARS coronavirus Rachiplusia ou MNPV Cactus virus X Streptococcus pyogenes phage Vibrio phage Hepatitis A virus Human herpesvirus 2 Flammulina velutipes browning virus Human adenovirus African swine fever virus Hyphantria cunea nucleopolyhedrovirus Acinetobacter phage Prochlorococcus phage Spodoptera frugiperda ascovirus Ectocarpus siliculosus virus Ambrosia asymptomatic virus Fig latent virus 1 Peanut clump virus Rhesus cytomegalovirus Visna/Maedi virus Mammalian orthoreovirus Wood mouse herpesvirus Broome virus Gallid herpesvirus 2 Human immunodeficiency virus Human herpesvirus 5 Apple stem pitting virus Sodalis phage Trichoplusia ni ascovirus Wolbachia phage Infectious salmon anemia virus Yellow fever virus Bovine viral diarrhea virus Human papillomavirus Escherichia phage Pseudomonas phage Human herpesvirus 1 SARS coronavirus Human herpesvirus 8 Pepper severe mosaic virus Hamster polyomavirus Duck hepatitis virus Deftia phage Rice tungro bacilliform virus Vaccinia virus Clostridium phage Epizootic haematopoietic necrosis virus Zygocactus virus X Human rotavirus Anguillid herpesvirus Shrimp white spot syndrome virus Bombyx mandarina nucleopolyhedrovirus Staphylococcus phage Listeria phage Marseillevirus Ralstonia phage Erwinia phage Mycobacterium phage Mammalian orthoreovirus 3 Myxoma virus Enterobacteria phage Lactobacillus phage Cyprinid herpesvirus 3 Helicoverpa armigera nucleopolyhedrovirus Crow polyomavirus Brochothrix phage Emiliania huxleyi virus Chrysodeixis chalcites nucleopolyhedrovirus Apocheima cinerarium nucleopolyhedrovirus

    sss
    KGAI    

    Influenza (Flu vaccines reduce AD risk) Bovine foamy virus Bat coronavirus Bovine viral diarrhea virus Leucania separata nuclear polyhedrosis virus Mink coronavirus Taura syndrome virus Bacillus phage Pseudomonas phage Listeria phage garlic latent virus Clostridium phage Invertebrate iridescent virus Marseillevirus Lymantria xylina MNPV Swinepox virus Synechococcus phage Paramecium bursaria Chlorella virus Beluga Whale coronavirus Emiliania huxleyi virus Dengue virus Grass carp hemorrhagic virus Infectious bronchitis virus Potato virus Y Human coxsackievirus Influenza B virus Klebsiella phage Apple stem pitting virus Acanthocystis turfacea Chlorella virus Sugarcane streak mosaic virus Murid herpesvirus 1 Gallid herpesvirus 2 Phlebiopsis gigantea mycovirus Streptococcus pyogenes phage Ryegrass mosaic virus Staphylococcus phage Powassan virus Nariva virus Felid herpesvirus 1 Sorghum chlorotic spot virus Sunflower chlorotic mottle virus Cymbidium mosaic virus Yaba-like disease virus Deftia phage Brochothrix phage Ljungan virus Torque teno virus Deerpox virus podovirus Acanthamoeba polyphaga mimivirus Choristoneura occidentalis granulovirus Haemophilus phage Lumpy skin disease virus Lactococcus lactis phage Canarypox virus Burkholderia ambifaria phage Sweet potato feathery mottle virus Burkholderia phage Mycobacterium phage Spring viraemia of carp virus Grapevine leafroll-associated virus Human immunodeficiency virus 1 Human herpesvirus 8 Mammalian orthoreovirus Chrysanthemum stem necrosis virus Enterobacteria phage Hendra virus Tellina virus Adoxophyes orana granulovirus Duck hepatitis A virus Rice tungro spherical virus Streptococcus phage Cyanophage Acinetobacter phage Roseophage harvest mouse papillomavirus Influenza A virus Arabis mosaic virus Citrus psorosis virus Squash mosaic virus Halomonas phage Allpahuayo virus Bacillus phage Peach chlorotic mottle virus Avian paramyxovirus Ostreid herpesvirus St. Louis encephalitis virus SARS coronavirus Yersinia phage Carnation Italian ringspot virus Ostreococcus tauri virus Infectious salmon anemia virus Enterococcus phage Muromegalovirus Pyrococcus abyssi virus Chilli veinal mottle virus Enterococcus phage Erwinia phage Tobacco mild green mosaic virus Iodobacteriophage Citrus idaeovirus Prochlorococcus phage Crimean-Congo hemorrhagic fever virus Debaryomyces hansenii virus Pepper veinal mottle virus Vibrio phage Diatraea saccharalis densovirus Human rhinovirus Bordetella phage Watermelon mosaic virus Goatpox virus Pellor

    xxx
    Multiple Sclerosis            

    Epstein-Barr (no filter)Many studies have implicated the Epstein-Barr virus in Multiple sclerosis

    EIF2B causes vanishing white matter disease

    ATPBD4 SF1 NRARP SOCS7 PKD2 CDAN1 RASA4 IER3 ZC3H18 CEP135 CC2D1B SAV1 FAM8A1 KANK2 UNG COL18A1 GPR128 FAM120C QSOX2 PLEKHG4 PLEKHG5 EMID1 ANXA6 AKAP13 SPIB LAG3 DKK2 fertilin beta BRAP PLCE1 MUC5B TPRN PLEKHA7 VEGFA STXBP5L alpha-1,4-galactosyltransferase EXO3CL2 HK3 peripheral myelin protein 22 MCM3AP MTSS1 ABCA7 RAB3IP HLA-B associated transcript 3 PPP1R14B PLXNB3 NUDT14 bullous pemphigoid antigen KAZ TRIP6 MPEPL1 ZAP70 IRAK1 ATE1 MUC16 CIT DRPLA RAI1 GPR124 HTR3C calcium channel, voltage-dependent, L type, alpha 1D RRM2B SRRM3 RBM25 CCDC90A DOK7 DNAJC14 TSPAN3 ELN REEP1 BCL2L12 TTC19 INS-IGF2 SYNGR2 MSLN BRD4 MLLT1 MA HNRNPUL1 eukaryotic translation initiation factor 4 gamma 3 STAB2 SLC6A5 MTCH1 WIZ IQCK MEOX1 IMMT CRIPAK MED15 MAVS RGL3 GPRIN1 MHC class I antigen immunoglobulin heavy chain variable region ZCCHC24 TBC1D9 PCD10 RPGRIP1L EGLN2 CEACAM16 WNK2 PLEKHH1 RRM2 DDX31 RRM1 ADNP2 WNK1 TOM1 MUC2 MUC12 MON1B ZNF280B ZMYM3 PARVA CUX1 SPRR2D FBLN2 SMPDL3A ACACB TMEM132A GRM7 RASSF7 MAN1A1 XIRP1 ODF3B RGMB ABCB11 TWF1 HMX1 TSC2 C2CD3 CDKL5 PRDM16 T calcium channel alpha 1G subunit LCN8 DYNC1LI2 LOC100129852 ZDHHC14 GAA PRNP COL4A3 TSL CHRNA4 IMPG1 PHYH RAB44 COL1A1 ryanodine receptor 3 ZNF318 DPH2 ZNF579 NCOA6 PPM1H PKN1 KDM4B CEBPA ROBO4 PTCHD2 FBXO17 IL1F10 SDK2 RCN2 OAZ1 ITGB2 ALDH1L1 MAPRE3 AATK ANKRD11 neuregulin 1 SCRIB CD80 PLCH2 MTFMT Epstein-Barr virus induced gene 3 OPN4 CCBE1 SRRM4 SRD5A1 ANKRD33B CAMK2B WDR67 ADRB1 LIPT2 CCDC12 PRICKLE1 MTRF1L RNASEK SGK2 POLA1 MARVELD3 TNFRSF25 SLC45A3 CCDC102A ALDH3A1 ST8SIA3 POLD1 HSCB PNLDC1 TRIM26 CASKIN1 SLC39A7 MUC5AC PRRT4 LINGO1 UBE4B VEGFR1 REV3L TTYH1 UPS42 NLGN2 RAPGEF1 PIDXL RGH14 CTAGE5 ADAM33 SYNJ1 EFR3B RAMP3 SLC4A11 MTX1 GREB1L immunoglobulin kappa light chain variable region ERN2 IL10 UBR5 MARCH9 PLXNA4 FOXC2 IDUA PSMB11 TCP10L2 NXPH4 PRX BSCL2 ZNF173 ATXN2 PFAS TGFA PIF1 schwannomin interacting protein 1 C2CD4D TUBB8 FOXK1 SSH1 sodium channel nonvoltage-gated 1 delta AFAM2 TCEB3B ZNF716 SLC25A48 PRKCA TCP10 cytochrome oxidase subunit II SHANK1 TPBG AHCYL2 LTC4S PLEKHA4

    284
     
     
    28280
      IFNAR1 CBLB PARD3B NFASC POU2AF1 MBP CD97 CLDN11 MATN3 MMP28 RNF19A RAD54B C6orf27 LAMB2 HTATIP2 TRIM15 TNFSF12 XRCC1 T cell receptor alpha RPL19 CD2 OPTN eIF2B OGG1 PDE4B HS3ST2 IL22RA1 LEKR1 DARS2 DCLRE1C KCNB2 TMEM39A SMUG1 CD247 BRCA2 IRF5 BUD13 PDZRN4 ECE2 CACNG4 SLC44A4 NUDT4 KLC1 IL16 CEP170 CENPC1 PREP CD2AP NHEJ1 HLA-DRB5 ERCC1 GFI1 CYFIP2 EVI5 EN1 PKN1 PLCE1 ZP4 HLA-DRA CIITA MMP25 MMP9 RAD51 KCNJ7 C4A GABBR1 LIG3 MX1L XRCC2 TKT IL7R CNP FMN2 GRN PAM LMNB1 HAVCR2 ZIC1 WDR64 RPA1 PCSK5 immunoglobulin gamma heavy chain SHROOM3 ADNP RAD23A OLIG1 HDAC11 ALS2 NBN ICAM3 RAD54L FH CBLN2 TLR3 EPC1 WDR7 MNAT1 NRLP11 SH2B3 CD58 FEN1 GBP1 SNPH KIF1A MUTYH KLRB1 RFC1 RAD51L3 XRCC3 CNTF SPG11 SLC25A36 POLG CYP27B1 MPG VPS54 VAV2 OAS3 CCNH NTHL1 PTPRZ1 CYP24A1 CLEC16A T-cell receptor beta APEX2 RAD51C ADAMTSL1 HELZ NEIL2 BDNF MYO9B METTL1 MUS81 SPARCL1 CHRND FLNA C4orf33 BICD1 KIF21B CYP4V2 IRF9 KANK1 LILRA3 BANK1 PGGT1B HSPB2 MPHOSPH9 T cell receptor delta POLE WT1 LINGO1 ENTPD1 RGNEF POLD1 OLIG3 ADAMTS14 CASP8 JARID2 SH2D2A XAB2 EME1 OPN3 NDUFS5 CTGF POL3RC CNTN2 SCHIP1 USP31 SLC25A27 DCP1A H6PD GDF5 GPC5 HCRT IFNGR2 XRCC4 PARP2 PRKDC PSMD2 ERCC8 NCKAP5 PDMB9 RAD52 TSC2 C1orf125 BSV CD6 FURIN ADAD1 ALK CD200R1 ERCC3 SMAD7 ERVWE1 SYN3 MMS19 IFIH1 ASAP1 MERTK RGMA  
    Autoantigens     VP none    

    Crystallin CRYAB

    BLAST Autoantibodies identified by microarray

              xxx

    CNP NP_149124:2',3'-cyclic-nucleotide 3'-phosphodiesterase

     

    BLAST

    Murid herpesvirus 4 Autographa californica nucleopolyhedrovirus Feline immunodeficiency virus Klebsiella phage Butterbur mosaic virus Human herpesvirus 6B Influenza A virus Bacillus thuringiensis phage Acanthamoeba polyphaga mimivirus Human parainfluenza virus Ectocarpus siliculosus virus African swine fever virus Canine calicivirus Bovine papular stomatitis virus Gallid herpesvirus 3 Human coxsackievirus Lassa virus Ostreococcus tauri virus Pseudoalteromonas phage Duck hepatitis A virus Shallot virus Mopeia virus Porcine teschovirus Human astrovirus Clostridium phage Prochlorococcus phage Anticarsia gemmatalis nucleopolyhedrovirus] >gb|ABI13886.1| polynucleotide kinase/ligase [Anticarsia gemmatalis nucleopolyhedrovirus Gossypium darwinii symptomless alphasatellite Epizootic haematopoietic necrosis virus Equid herpesvirus 1 Verbena latent virus Human herpesvirus 6] Human parechovirus Microplitis demolitor bracovirus Cyanophage PSS2 Agrotis segetum granulovirus [Ovine adenovirus Canine papillomavirus Heliothis virescens ascovirus Tree shrew adenovirus Hyperthermophilic Archaeal Virus Mopeia Lassa reassortant 29 Lymphocytic choriomeningitis virus Avian paramyxovirus Tomato yellow leaf curl Sardinia virus Mycobacterium phage Infectious bronchitis virus Hepatitis delta virus Blackberry virus Y Pseudomonas phage Acidianus two-tailed virus Human herpesvirus 3 oa semilatent virus JC polyomavirus Meleagrid herpesvirus Pseudocowpox virus Helleborus net necrosis virus Streptomyces phage Canine distemper virus Acinetobacter phage bovine viral diarrhea virus Bathycoccus sp Rachiplusia ou MNPV Human respiratory syncytial virus Grapevine fleck virus Burkholderia ambifaria phage Paramecium bursaria Chlorella virus Watermelon mosaic virus Avian hepatitis E virus Peste-des-petits-ruminants virus Tiger frog virus Influenza B virus Human enterovirus Nanovirus-like particle Equine encephalosis virus Bovine polyomavirus Leucania separata nuclear polyhedrosis virus Ambystoma tigrinum virus Chinese wheat mosaic virus Rice tungro spherical virus Emiliania huxleyi virus Soft-shelled turtle iridovirus Goatpox virus Hepatitis B virus Toscana virus Cowpox Bear Canyon virus Feline calicivirus Burkholderia phage Human herpesvirus 2 Semliki forest virus Trichoplusia ni ascovirus Human adenovirus Human herpesvirus 5 BK polyomavirus Barley stripe mosaic virus VP8 [Micromonas pusilla reovirus] >gb|AAZ94048.1| VP8 [Micromonas pusilla reovirus] Eyach virus Shigella phage Nicotiana velutina mosaic virus Gallid herpesvirus 1 Venezuelan equine encephalitis virus Cymbidium mosaic virus Peanut clump virus Porcine rubulavirus] Human rhinovirus Soybean mosaic virus Ectromelia virus Asian prunus virus Cherry green ring mottle virus Phaius virus Escherichia phage Narcissus symptomless viru Human immunodeficiency virus 1 Kalanchoe latent virus Ralstonia phage Beet necrotic yellow vein virus Buggy Creek virus Horseradish latent virus Human parvovirus Wheat yellow dwarf virus-RPV Lactobacillus phage Bovine parainfluenza virus Bovine leukemia virus Liao ning virus Human echovirus Simian picornavirus Bacillus phage Bovine herpesvirus 5 Canine coronavirus Synechococcus phage Maize chlorotic dwarf virus Bovine enterovirus Clover yellow mosaic virus Human bocavirus Kashmir bee virus Wood mouse herpesvirus Zygocactus virus Hepatitis C virus Human herpesvirus 4 Potato virus Alcelaphine herpesvirus 1 Grapevine rupestris stem pitting-associated virus Rhodothermus phage Staphylococcus phage Equid herpesvirus 4 Abalone herpesvirus Beet soil-borne mosaic virus Grapevine fanleaf virus Morogoro virus Turkey coronavirus Murid herpesvirus 2 Vibrio phage Edge Hill virus Spinach severe curly top virus Aeromonas phage Borna disease virus Garlic virus Streptococcus phage
     

    Myelin oligodendrocyte protein No filter

    none Red viruses in all cases have been implicated as risk factors or disease modifying agents in MS or in demyelination; These are linked to Pubmed

    Nemesia ring necrosis virus Feline infectious peritonitis virus (cat ownership linked with MS) Seoul virus Lumpy skin disease virus Spodoptera litura NPV Nyamanini virus Grapevine chrome mosaic virus Human herpesvirus 4 Hepatitis delta Beet western yellows Bacillus phage Turnip mosaic virus Streptococcus pyogenes phage Heliothis armigera cypovirus Emiliania huxleyi virus Bovine enteric calicivirus Clostridium phage Cypovirus Acanthamoeba polyphaga mimivirus Citrus tristeza virus Border disease virus Epstein-BarrMurine hepatitis virus Marseillevirus Merino Walk virus shrimp white spot syndrome virus coxsackievirus Human immunodeficiency virus Yokose virus Human astrovirus Avian orthoreovirus Mycobacterium phage influenza a Mokola virus poliovirus Phocoena spinipinnis papillomavirus Bombyx mandarina nucleopolyhedrovirus Watermelon mosaic virus Gallid herpesvirus 2 Temperate phage Mumps virus Louping ill virus 101

    Myelin associated glycoprotein

    No filter

    MAGVPnoneEnterobacteria phage Mamestra configurata Corynebacterium phage Lily virus X Psittacid herpesvirus Adult diarrheal rotavirus Yersinia phage Mycobacterium phage Vibrio phage Influenza A virus Papillomavirus Euproctis pseudoconspersa nucleopolyhedrovirus Pseudomonas phage Streptococcus phage Actinomyces phage Pelargonium zonate spot virus Lactococcus phage Molluscum contagiosum virus Marseillevirus Bacillus phage Burkholderia phage Human herpesvirus 5 Allium virus Musca domestica salivary gland hypertrophy virus Epstein-Barr Colorado tick fever virus Staphylococcus phage Ralstonia phage 111
    Myelin Basic protein Theiler's encephalomyelitis virus Epstein-Barr Bean yellow disorder virus Rotavirus A Influenza A Citrus tristeza virus Measles virus Yersinia phage Lactococcus phage Rabbit hemorrhagic disease virus Enterobacteria phage Broome virus Campylobacter phage Human herpesvirus 3 Human herpesvirus 2 Listeria phage Human adenovirus 4 Human herpesvirus 7 Hepatitis delta Polyoma virus Human T-lymphotropic virus Newcastle disease virus Sapovirus Pepino mosaic virus Hepatitis C Torque teno virus sea trout rhabdovirus Banna virus Rubella virus Marseillevirus Hepatitis B Rice stripe virus Human parvovirus Norovirus Bacillus phage Felid herpesvirus 1 (cat ownership) 123
    EIF2B5 Not demonstrated as an autoantigen, but homologous with Epstein-Barr Enterococcus phage Ateline herpesvirus 3 Mouse parvovirus Canine papillomavirus (Dog ownership) Human herpesvirus 8 Yersinia phage Human herpesvirus 5 Latino virus Bacillus thuringiensis phage Murid herpesvirus 2 Oryza rufipogon endornavirus Canarypox virus Bean common mosaic necrosis virus Haemophilus phage Actinoplanes phage Equid herpesvirus 4 Mycobacterium phage Human adenovirus Streptococcus phage Human herpesvirus 1 Human enterovirus Corynebacterium phage Ralstonia phage Alfalfa mosaic virus Burkholderia phage Rubella virus Bacillus phage Helicoverpa armigera NPV Hepatitis C Enterobacteria phage Klebsiella phage Equine rhinitis B virus Escherichia phage Acidianus two-tailed virus Tupaiid herpesvirus Cyprinid herpesvirus 3 Norwalk virus Hyperthermophilic Archaeal Virus Lymphocystis disease virus Human metapneumovirus Spinach latent virus Camelpox virus Saimiriine herpesvirus 2 Listeria phage Trichoplusia ni SNPV Ostreococcus virus Poliovirus SARS coronavirus Soybean chlorotic mottle virus Staphylococcus phage Choristoneura occidentalis granulovirus Streptomyces phage Porcine adenovirus Shigella phage Ostreococcus tauri virus 1 Marseillevirus Vibrio phage Japanese encephalitis virus] Agrotis ipsilon multiple nucleopolyhedrovirus Ictalurid herpesvirus 1 Mumps virus Cowpox virus [Botrytis cinerea debilitation-related virus Variola virus Lactobacillus phage Suid herpesvirus 1 Human herpesvirus 4 Shrimp white spot syndrome virus Plutella xylostella granulovirus Lactococcus phage Felid herpesvirus 1 Clanis bilineata nucleopolyhedrosis virus Acanthamoeba polyphaga mimivirus West Nile virus Glossina pallidipes salivary gland hypertrophy virus Human herpesvirus 6 Measles virus Rachiplusia ou MNPV Ectocarpus siliculosus virus 1 Musca domestica salivary gland hypertrophy virus Clostridium phage Human herpesvirus 3 Human papillomavirus Human herpesvirus 7 St. Louis encephalitis virus Human coronavirus Taterapox virus Epstein-Barr Equid herpesvirus 9 Citrus psorosis virus Haloarcula phage BLAST

    Schizophrenia

    Autoantigens reported in schizophrenia are homologous to proteins expressed by the pathogens implicated in schizophrenia: The size of the tags corresponds to the number of pathogen hits for each antigen

    Autoantibodies in schizophrenia from : Viral or pathogen homologues are tag clouded in blue: Varicella = Herpesvirus 3

     
    CHRNA7 Rubella Rhinovirus Toxoplasma Herpesvirus 3 Borrelia Herpesvirus 2 Influenza  
    CHRM1 Herpesvirus 2 Herpesvirus 3 Borrelia Influenza Toxoplasma Rhinovirus Rubella  
    CHRM2 "Error occurred while trying to set up a Blast Object from CGI context: CFastaReader: Input not marked as defline or comment, but contains too many special characters to be plausible data" (Too many hits saturated the NCBI server)  
    DRD2 Herpesvirus 3 Herpesvirus 2 Influenza Borrelia Rubella Rhinovirus Toxoplasma  
    GRIN1 Toxoplasma Herpesvirus 2 Influenza Herpesvirus 3 Borrelia Rubella Rhinovirus  
    ELANEToxoplasma Rhinovirus Borrelia Herpesvirus 2 Influenza Rubella Herpesvirus 3  
    OPRM1 Herpesvirus 3 Rubella Borrelia Herpesvirus 2 Influenza Toxoplasma Rhinovirus  
    nerve growth factorRhinovirus Borrelia Herpesvirus 2 Herpesvirus 3 Rubella Toxoplasma Influenza  
    HTR1A. Rubella Rhinovirus Herpesvirus 3 Toxoplasma Influenza Herpesvirus 2 Borrelia  
    HSP60 Influenza Rhinovirus Herpesvirus 2 Toxoplasma Rubella Borrelia Herpesvirus 3  
    HSP70 (HSPA12A)Influenza Toxoplasma Herpesvirus 3 Rubella Herpesvirus 2 Borrelia Rhinovirus  
    HSP90 Rhinovirus Influenza Herpesvirus 2 Rubella Borrelia Herpesvirus 3 Toxoplasma  
    PAM/MYC Herpesvirus 2 Rubella Herpesvirus 3 Borrelia Toxoplasma Influenza Rhinovirus  
    S100B Toxoplasma Borrelia Influenza Rubella Rhinovirus Herpesvirus 3 Herpesvirus 2  
    STRN Rubella Rhinovirus Toxoplasma Influenza Borrelia Herpesvirus 2 Herpesvirus 3  
      DISC1(theoretical antigen as prediced by Bepipred)
    Influenza Toxoplasma Herpesvirus 2 Rubella Borrelia Rhinovirus Herpesvirus 3
    BLAST
    DISC1 BLAST vs. all viruses (AIDS not included) BLAST  
        DISC1 BLAST Results vs. Influenza Varicella HSV-2 Rubella  
    In the tables below each virus/pathogen (translated genome) was BLASTed vs. the human proteome: The gene symbols are sized according to the number of viral hits per protein (of vatches of 5 or more contiguous amino acids): Together, these pathogen matches account for the products of ALL schizophrenia susceptibility genes so far described in genetic association studies (over 600) See Schizophrenia genes  
    HERV-W schizophrenia Filter schizophrenia
    BRPF3 BRD1 KIF13A BAI3 UBAC2 STXBP1 SP4 ANK2 NRXN1 STAB1 CBR1 QK1 HTR3A HNRNPA2B1 SLC18A2 GABBR1 INA GFRA1 STK24 CEP63 ALDH1A3 RAI1 SYN2 ARNTL2 AP3B2 ATP2A2 TMTC4 APOL4 NPAS1 GRM2 DDC NRXN3 KIF21A KCNH7 CACNG2 MYO1D TPM1 LIF PDE10A GABRG1 MAP6 GPC1 HDAC10 CSPG5 WDR1 ARHGEF10 NRG1 NFIL3 GRIN2D ADAM28 ME3 ST6GAL2 PAK3 ACSM1 HIST1H2AH GRIA4 GABRB1 GNB1 GRIA2 CARTPT SULT4A1 CABIN1 GNAI2 SPRY4 HDAC4 NCOA7 HOMER1 PIK3C2G MAP1A DAO KCNN2 CTNND2 ST8SIA2 PAFAH1B1 PAICS NEFL ZBT20 OMG VGF GLUL SPTBN4 MEGF10 MLC1 PPP3CC ERVWE1 NDUFS1 DKK1 PDE7B TKT TUBB2A SEL1L3 SLC25A3 YWHAH UNC5C HIST1H2AG EIF3D EIF4A2 NLGN4X JARID2 RGS9 SNX6 GRM3 TMEM200C EGR4 TH CIT CYP26B1 IMPA2 ITIH1 ATCAY PTGFRN LRRMT1 GDA SLCO3A1 STX7 ANK3 GNPAT HOMER2 OLFM1 PCM1 FNIP1 TBCB HOMER3 BACE1 CELSR1 SLITRK2 UTRN GRID1 GPR125 NALCN DOCK9 DRD5 NDUFV2 HNTPNU MPZL1 DCTN2 ABCA13 HTR3B KCNH2 PLXNA2 ATF7IP TPI1 GRIN3A RPGRIP1L MTIF3 ZNF184 TNR AHI1 GRIN2A HTR2A GRIK5 COMT ARVCF GRIK3 VAMP2 APOL1 HSPD1 CCDC141 EPHA6 NTNG2 MCHR1 GRIA3 ASTN1 CHRFAM7A MDGA1 SPTAN1 HTR7 MUTED RAPGEF6 RASF7 PDE4B HIPK3 DISC1 MBP GFRA3 RSRC1 ABCA7 PRKCG ADAMTS4 DLD PRSS16 GRIP1 GFAP NOTCH4 NBEAL2 CACNA1B SIRPB1 MAP1B PCNT PI4KA TIM44 DTNBP1 PNP0 MCTP2 HTR3E LSAMP SEMA3A TAAR6 ARHGAP18 NRCAM HTR5A HTR1A CPLX2 NOVA1 MAPT LANCL2 UCHL1 ZNF804A COX1 DRD2 CSF2RB NEFH DRD3 SIGMAR1 GRM7 GPR85 CLDN10 LAMB2 DCDC2 NEUROG1 NRG3 PCDHA1 RET BIVM CLINT1 GRIK1 KCNQ5 IMMT DZIP1 DGKI DNAJC6 UGGT2 DRP2 GRM4 CNTN4 FEZ1 SYN3 BHLHE41 APP STRN GNB2 ANKHD1 MOG PCDH11Y CYFIP1 KCNH6 OPHN1 RELN DGCR14 ALDH1A2
     
    Bornavirus

    DISC1 CACNA1C ABCA13 RPS10 HAPLN2 ST7 GNB2 MAP1B involved HSPA12A BRPF3 MYT1L GRIK1 CSF2RB VGF involved GPR109B ref PCLO TLE3 MCTP1 ref DMTF1 PER1 RORA ref VIP ref SCN8A ODZ4 GABRE FAT4 DOCK9 ref FABP7 BASP1 implicated FXYD6 SEL1L3 ROR1 ref NXN ATP2A2 ref SLITRK2 ref GABRP MCHR1 NOVA1 SPTAN1 ASTN1 STXBP1 SLC6A2 KCNN3 ref SYN2 GRIN3A COX2 CACNA1E FABP3 NRG1 NFIA UGGT2 NCKAP5 TMTC4 ANK3 DGKH GRIN2B GRM2 DGKI ref CHRNA7 ATP8B3 ZNF804A CUX2 ref NTNG2 implicated UACA FAAH ref CNTNAP5 COX1 XBP1 NALCN STK24 CSNK1E ND3 MDGA1 DPY19L3 ref ND5 c18orf1 ARNTL ref TCF7L1 GRIN2A VIPR2 ref INPP1 ref GABRQ CHRNA10 IMPA2 COX3 THOC1 CTNNA2 SORCS2 GARNL3 FBN1 DPP10 GRIN2A KDELC1 ref ARNTL2 DHRS4 GPR125 PER3 CCDC149 PDLIM5 DSEL ZDHHC8 VAPA NPAS3 TDO2 ST8SIA5 ADCYAP1 GABRA5 RORB ADRBK2 PRODH WNT2B CTSF YWAH UBAC2 GPR18 ND4L NDUFV2 ND4 JAM3 NCS1 ARNT2 RTN4 TSPAN8 SLC17A6 FZD2 MC5R ND1 NAPG SLC17A7 DNAJC3

    9946

    Filter schizophrenia

    Red genes have also been implicated in Bipolar disorder

    Seroprevalence in adult schizophrenics

    HSV-2
    PLXNA2 GRIN2A ALDH1A2 FBCL21 ADSS DRD2 KCNN3 PCM1 SLC17A1 TAAR6 UHMK1 MPZL1 VRK2 SNAP29 RGS4 GRM4 CACNA1C TXNDC5 CIT NTNG1 CSF2RB DGCR6 GNL3 GABBR1 PRSS16 HTR2C NDUFV2 PCDH8 HTR2A DGCR2 SYNGAP1 FXR1 ZDHHC8 GNAL MC5R NDEL1 DBH CDKN2A NEUROG1 PADI2 ND2 CCKAR GRIN2D ATP6 BT2NA2 HIST1H2AG ENO2 HTR5A MLC1 FABP7 SLC1A4 MYH9 ASTN2 CHRNA7 NPAS3 ADCYAP1 PPP3CC ADAM12 TUBA8 GRIN3A POM121L2 NDE1 DLG4 FZD3 GCLM HOMER1 AHI1 PTBP2 HOMER2 MAG ABCA13 MICB MAPK14 MAP6 PNPO GRIA4 FCYD6 NTF3 DRD4 GRM7 NUMBL TSPAN8 TPH1 HSPA12A SYN3 DKK4 CSPG5 GABRP SP4 CYTB CCDC60 GABRA1 PDLIM5 DRD3 PLA2G4C ARVCF HIST1H2AH GRID1 IL1A GRP78 SLC06A1 MEGF10 PPP1R1B DTNBP1 RPGRIP1L CHN2 PRODH HTR7 COMT SLC1A3 PDE4B KPNA3 NOS1AP ALDH3B1 GRM3 JARID2 NOTCH4 NRG1 DLX1 RELN MCTP2 MDGA1 NRXN1 GRIA3 YWHAE TH ALK ANK3 DISC1 NPTN GNB1L NRG3 SHISA5 PDE4D ACSL6 GRM5 PLAA ZNF74 IMPA2 SMARCC1 BTN3A1 ASTN1 DAO TSPO SLC17A3 DISC1 FGF14 SYNGR1 ARHFGEF10 MAP4 BRD1 FEZ1 CSF2RA SLC6A5 GFRA1 DDC KMO DRD5 UFD1L ZNF804A TSNAX HTR6 RAPGEF6 CHRM5 SYT11 YWHAZ SLC17A7 KCNH2 DRD1 MUTED DAOA SIRT5 RTN4R MYT1L SYN2 EGR2 HRH2 OPRM1 SRR SPARCL1 HTR1A CABIN1 TRAF3IP1 PEMT HIST1H2BJ ARHGAP18

    14088
    Filter schizophrenia Maternal infection identified as a risk factor in schizophrenia
    Influenza
    PDE4B KCNN3 DKK4 NRG3 YWHAE GABRP ZDHHC8 CACNA1C SPARCL1 MC5R NTF3 UHMK1 TPH1 POM121L2 CABIN1 PCM1 SYN2 PRODH HTR2C ASTN1 FZD3 GNAL GCLM NRXN1 HSPA12A ALDH3B1 ARVCF HTR7 HOMER2 DTNBP1 UFD1L NDE1 ND2 PPP1R1B RELN SIRT5 DRD2 MAP6 DRD3 HTR1A SLC06A1 ALK HTR2A MCTP2 SLC17A3 CHRNA7 ATP6 NPTN MUTED FBCL21 JARID2 NDUFV2 IL1A PCDH8 OPRM1 MEGF10 VRK2 SLC17A1 SHISA5 CIT NDEL1 PLXNA2 TSPO CSPG5 PRSS16 TXNDC5 ALDH1A2 CHN2 SLC1A4 NPAS3 MAG SYN3 TSNAX HTR6 DGCR6 MLC1 FCYD6 ANK3 DLX1 SYNGR1 ARHFGEF10 CSF2RA MAP4 PLAA KMO GNL3 CYTB EGR2 CDKN2A FXR1 DAO DLG4 GRIN3A SP4 CHRM5 DISC1 GRM3 GRID1 DRD1 GRIA3 SLC17A7 SLC6A5 DRD5 NOS1AP ENO2 PTBP2 TH SYT11 TSPAN8 PLA2G4C IMPA2 GRIN2A TRAF3IP1 PEMT RGS4 TUBA8 GABBR1 MDGA1 AHI1 CCDC60 SNAP29 DDC MPZL1 ZNF804A ASTN2 GRM4 CCKAR RAPGEF6 NUMBL disrupted in schizophrenia DBH GFRA1 GNB1L PDLIM5 GABRA1 MYT1L SMARCC1 HOMER1 ZNF74 FEZ1 BRD1 DAOA DRD4 KPNA3 BTN3A1 GRM7 HIST1H2AG FGF14 GRIA4 HIST1H2AH SYNGAP1 NTNG1 KCNH2 FABP7 GRIN2D SLC1A3 MAPK14 MYH9 PDE4D HRH2 ACSL6 DGCR2 ADAM12 NEUROG1 HIST1H2BJ RPGRIP1L SRR CSF2RB HTR5A MICB ADSS GRM5 COMT PNPO ARHGAP18 PPP3CC BT2NA2 ABCA13 YWHAZ NRG1 TAAR6 ADCYAP1 GRP78 NOTCH4 PADI2 RTN4R
    4224

    Filter schizophrenia

    Maternal infection identified as a risk factor in schizophrenia
    Rhinovirus

    EGR3 GRM3 CABIN1 ABCA13 DRD1 ITIH3 JARID2 DBH GRIN2A FXR1 GRIA1 MC5R PADI2 DRD2 GNB1L ORC3L KCNH2 UHMK1 SIL1 MCHR2 GRM4 ZNF804A RELN GRIA3 DISC1 DKK4 DRD5 RPGRIP1L NOS1AP ADCYAP1 POM121L2 ADSS PDE7B DGKI NDEL1 HSPA12A ASTN2 PPP3CC IL1A MYH9 NOTCH4 INTS6 SP4 VRK2 GRM5 ESR1 NRG3 PB1 TMEM108 FZD3 PFN4 CHL1 AK1 GRIA4 ACSL6 DGCR5 CLOCK CACNA1B PNPO SPARCL1 MUTED OPCML ZDHC8 MAP4 DAOA NUMBL CHRNA7 ND2 SLC1A6 CHRM5 SYN3 PTBP2 COX1 ARHGEF10 PK3C2G DAO GNL3 SYT11 TSPAN8 MAPK14 GRIN2D HTR7 SLC17A7 CIT LIF ST8S1A2 CSF2RA PDE4B HTR2C ASTN1 HIST1H2BJ HTR1A NPAS3 SYN2 MCTP2 APOL2 NPTN TXNDC5 PLAA SLC1A3 DGCR6 FEZ1 DRD3 EGR4 SGCR6 CHRFAM7A CTNND2 C10orf120 ANK3 HRH2 CLINT1 PRSS16 HTR2A MRCL3 MRLC2 DLX1 FGF14 DISC2 PNPLA8 TH GABRP COMT GRM7 GLRA2 MICB PCQAP DRD4 ARVCF GRIA2 PDLIM5 OPRM1 SLC6A5 CNP CLDN5 CHI3L1 BRD1 CCKAR HOMER1 NRXN1 GRIK3 SLC1A4 DPYSL2 HTR6 ENO2 GNPAT SULT4A1 ABCA1 TDO2 MCHR1 PLA2G4C GABRB2 TAAR6 IMPA2 GABBR1 SLC18A2 ND4 KPNA3 CSF2RB CACNA1C NOS1 RAPGEF6 NRG1 NDUFV2 BTN3A1 ANKK1 MACF1 DGCR2 MLC1 MAP6 MAG SHISA5 MDGA1 PRODH RGS4 GFRA3 AHI1 ALDH3B1 ARHGAP18 ZBED4 NTF3 GABRA1 CTLA4 ZNF184 SLC17A3 PPP1R1B SYNFAP1 MYT1L SMARCC1 FABP7 GRIN1 ADAM12 SIRT5 PCM1 CJN2 SYNGR1 HOMER2

    5260
    Maternal infection is a risk factor in schizophrenia
     
    Rubella

    GABRA1 HTR1A CSF2RA ERBB2 MEGF10 ERBB3 NDE1 HIST1H2AGA12A GNB1L TXNDC5 REPGEF6 ASCL6 NRG1 DRD4 SHISA5 ZNF804A ADCYAP1 JARID2 FXYD6 BTN2A2 TSNAX DAOA NEUROG1 SLC6A5 NDEL1 FZD3 RELN HTR5A FABP7 SYNGR1 HTR2A PCM1 FBXL21 NRXN1 SLC18A2 CHRNA7 NUMBL ARVCF GRIN2A HTR6 ALDH1A2 MUTED NOS1 GABRP GNAL SPARCL1 TSPO ND2 CCDC60 YWHAE KCNH2 DRD1 MLC1 CSPG5 PLXNA2 MYT1L NTNG2 MCTP2 GPC1 DAO VRK2 CCKAR ASTN2 DRD2 RTN4 DTNBP1 NDUFV2 CYTB SLC1A3 PPP3CC FXR1 GRM5 ASTN1 GRIN2D GRM7 PDE4B MICB AK1 PEMT PTBP2 SRR KCNN3 KPNA3 GRM3 GRID1 ARHGEF10 PLA3G4C NRG3 SYT11 EGR2 TRAF3IP1 MPZL1 CSF2RB GABRB2 GRIA4 GCLM SMARCC1 GRIK3 NTNG1 BDNF TH HRH2 ADAM12 PCDH8 MAG RTN4R ZNF74 YWHAZ NPTN ATP6 DRD3 SLC17A1 GRIA3 CHN2 HTR7 GFRA1 ANK3 GRM4 TSPAN8 GABBR1 CHRM5 PER1 TUBA8 IMPA2 ARHGAP18 NRGN MYH9 ENO2 HIST1H2AG NTF3 CABIN1 ERBB4 SIRT5 BRD1 HOMER2 HOMER1 SYNGAP1 GRP78 PDE4D PPP1R1B HTR2C SYN2 TAAR6 ALDH3B1 SLC1A4 SP4 HIST1H2BJ KREMEN1 SLCO6A1 TPH1 RPGRIP1L HIST1H2AH CLOCK PRSS16 PADI2 NOS1AP GRIN1 PDLIM5 DGCR2 MDGA1 CACNA1C ADSS GNL3 ZDHHC8 SYN3 CDKN2A MAP6 DGCR6 PRODH PLAA DISC1 KMO AHI1 ERBB1 MAP4 IL1A OPRM1 DRD5 COMT UFD1L NPAS3 UHMK1 NOTCH4 SNAP29 MAPK14 QK1 MC5R RGS4 POM121L2 DKK4 FGF14 SLC17A3 DBH FEZ1

    9452
    Prenatal infection is a risk factor in schizophrenia
    Filter schizophrenia
    Varicella
    MACF1 PDE4B NR3C1 KCNQ5 PAK3 ESR1 CTNND2 APP ACSL6 KCNH7 VRK2 CDC42SE2 FZD3 RPGRIP1L MYHP GPM6A GABBR1 INA STAB1 PCDHB11 GRM7 DRD2 FIGN CELSR1 MAP1A CPNE2 AP3B2 COX2 SULT4A1 HTR3A CELF4 PDE10A MICB CNTN4 PCNT HIPK3 CSNK1D IL1RAPL1 NEFM MCHR1 EGR2 LIFR RAPGEF6 CHRM5 RASSF7 CNTNAP2 AP3D1 NRG3 SPTBN4 MCF2 YWAH ANKHD1 PI4KA PCDH11Y PSMD10 GABRD NEUROG1 SLC6A2 NFIL3 PCM1 NRXN3 GNB1 DGCR14 FEZ1 ORC3L PTBP2 NPAS3 ZNF804A CSPG5 NUDT6 GTJA1 DDC SYNGR1 OMG HDAC4 KCNN2 NCOA7 CHRNA7 PRKCG PCDH8 AP3M1 DAO KCNH2 GRIK1 TRMT2A TRIM3 ZBER4 CIT RNH1 ANKK1 MBLN2 GRIN3A SEMA3B SLC26A6 PLXNA2 PAICS TRAF3IP2 SLC17A6 GRM2 ENTPD4 LAMB2 HTR2C HP1BP3 TPM3 PDE7B BAG3 ADAMTS4 DPYSL2 PLAA CHRFAM7A GPR109B CLDN10 GRM5 ND5 NPAS1 BRD1 CTXN3 HRH2 TNR BACE1 ASTN1 ARHGAP18 SLC6A5 NLGN4X NDUFS1 DNAJC6 AADAT ALDH1A2 TPH2 ITIH4 KREMEN1 PIP5K1B CACNA1C DBP GNPAT BRPF3 QDPR UTRN ATP2B2 GRIN2A ERVWE1 NTF3 DAG1 DGCR2 DOCK9 CSF2RA UHMK1 APOL3 SPARCL1 KIF13A MECP2 NTNG2 SIRPB1 NRXN1 DLGAP2 MAGEL2 TAAR6 EPHA6 ATP6V1A NRCAM MLEC USP4 LMNB2 CAMKV MCTP2 PCDHA1 NRG1 UGGT2 NOTCH1 DRD5 PADI2 DISC1 FNIP1 KIF21A EPB41L1 ARNTL2 GABRB1 STK24 NALCN ACLY RIMS2 ARID4B MAPK14 C1QTNF3 TPH1 GRIN2D GSK3A HTR3D ANK3 GABRA5 MAP6 DGKI MAPKAPK3 KIAA0513 GUCY1A2 ABCA13 SORBS1 CABIN1 PTGFRN SEMA3D RET RAI1 SLCO6A1 GRIN1 SLC25A3 MYT1L HTR7 STX7 SP4 VGF LANCL2 COMT NBEAL2 DBH MAP1B GRIK3 BTN3A2 RGS9 SRSF6 CACNA1B SETD2 HDAC3 ND1 GABRA1 GRIK5 NOS1AP ATP5A1

     

    12574
    Associated with schizophrenia in adulthood
    Filter schizophrenia
    Borrelia Burgdorferi
    TPM1 AKT1 IMMT ADAMTS4 GRIN2D SLC25A14 POM121L2 OPHN1 DZIP1 AHI1 RAPGEF6 GFAP SLC39A12 SEPT4 DLG1 SYNGR1 KCNH7 FSTL1 ALDH1A3 MTNR1A FBXL21 CNTN4 CCDC60 BRPF1 RAI1 KCNQ5 EPB41L1 ENO2 DISC1 PAK2 EPHA6 SMARCA2 RIT2 HTR3E ZNF804A GABRB2 CYP26B1 CACNA1B CEP63 TSNAX NR4A2 HSD11B2 SEMA3D CHN2 ATP2B2 SYNGAP1 DRD3 HTR6 SLC6A9 PDE7B TMTC4 SEL1L3 NRG1 AK1 GRID1 HSPD1 BIVM STYT11 FARSA TPI1 OFCC1 ST6GAL2 MCHR2 MEGF10 ANKK1 PCDH11Y COX2 GPR50 DRD2 SEMA3B AGBL1 DGCR2 DNAJC6 ATP5A1 SLCO6A1 PICK1 NUBPL ANK3 HSPA12A GRIA4 CCDC141 GSK3A SLC25A14 YWHAG UTRN CTNND2 NDE1 TRMT2A PADI2 GRIK1 ATP6V1B2 ERMN VRK2 PCDHA1 FIGN PCNT DRD1 AP3D1 MYT1L BAP1 ND2 HRH2 ATP2A2 CCDC149 FOLH1 SMARCE1 APEX2 GRIA3 GSPT1 CSPG5 NALCN SIRPB1 PDE10A MCTP2 GPR125 HTR2A ZBED4 MACF1 TRIM3 CHRNA7 SEMA3A CSF2RA TDO2 PIP4K2A GRIA1 YWHAZ PLA2G4C RCAN1 FEZ1 PRKAG2 GMPS HOMER3 SLC26A6 UQCRC1 LRRTM1 KCNE2 PCM1 TSPAN7 ACSL6 GRIK3 GABRA5 CAD TAAR6 SHANK3 GNPAT HTR3D GABBR1 LAMB2 KIAA0513 TH1L MAOB NOS1 BAI3 ADAM22 SLC32A1 PGK1 DPYSL2 YWHAB FAM8A1 POMC ASTN1 UBAC2 ST7 NCOA7 PGAM1 HTR3C OMG DDO ASTN2 PNPLA8 ERVWE1 PCMT1 SPARCL1 STXBP1 ARHGDIA GRM5 GNAL SEPT7 LIFR NBEAL2 GRM4 FXR1 RGS9 GABRG1 FGF14 SMARCC1 FZD3 GRIA2 PRKAG1 KIF21A NCS1 GFRA2 DAOA GRIK5 NLGN4X HDAC9 CAP1 PDE4B HTR3B FABP3 GRIN2AJA TUBA1B CPS1 DDAH1 SLITRK2 PAK3 ADSS HOMER2 SLC17A1 SLC1A5 AKR1D1 JARID2 PSMD10 MYO1D DRP2 KCNH2 DYM ATP6V1A NUMBL MAP1B BRD1 CNTNAP2 GRM3 CCKAR GPRASP2 RIC3 CIT BRPF3 PLXNA2 EFNB2 GCLC MBLN2 SPA17 KCNN3 FOXP2 ITIH4 CRYM NEFL HARS2 HSPA8 HS3ST2 IFNG SLC1A6 LSAMP DOCK9 HTR1A SH3GL2 MAP2 SYT5 RPGRIP1L SETD2 ABCA13 PIK3C2G PLA2G4C GRM7 AP3B2 IPO5 JAG1 ALOX12 NRXN3 PGBD1 CLU GAPDH ATF7IP UGGT2 UFD1L GRIP1 MAGEL2 PCDH12 NRCAM KIF13A NEFH DGKI RELN SPTAN1 NPAS3 CYFIP1 SRD5A2 ALDH3B1 ABCA7 TKT KCNN2 RLBP1 MLC1 DRD5 MCF2 IMPA2 NDUFV2
    UBAC2 TPM4 SLC17A6 APOL3 FOLH1B ENTPD4 MAP6 NDUFS1 TCF4 SLC17A7 CHL1 CABIN1 ACTG1 SNX6 RSRC1 COX1 RGS4 APOL6 PPP3CC SGCE PCDHA3 MYO1F ME3 DBP BTN3A1 RIMS2 PRODH ORC3 PRDX1 ACTB C1QTNF3 ADIPOQ BLOC1S1 TRAF3IP1 VIM SLC1A3 EIF4A2 HSD11B1 NRG3 BPRF3 ATP6V0D1 MYL12B DCDC2 FTO CHRM5 PPT1 NR4A3 KCNJ9 CACNG2 ERBB4 CEP63 SLC1A4 LMX1A WDR1 CSNK1D HS6ST3 CDC42EP3 GPR18 SIM1 NRXN1 HSPA8 STRN CRYAB GLUL ARHGAP18 ARID4B MAP4 KCNH6 UNC5C HSPD1 GDI1 SLC6A5 PRKAG3 ATCAY MOBP SLC1A2 KRTAP10-11 PGP CPLX2 PTGFRN KCNN2 ALDH1A2 ADCYAP1 APOL2 SYN2 APP USP46 ZDHHC8 TMEM200A GRM2 PITPNA CLINT1 SNAP29 HDAC9 PYGB
    17109

    Tick infestation and Borrelia associated with schizophrenia

    Schizophrenia

    Toxoplasma Gondii CCDC60 TAAR6 TSNAX ALDH3B1 NEUROG1 PRODH PDLIM5 COMT MAG GFRA1 SLC1A3 GABRP MDGA1 SLC6A5 DISC1 RELN MCTP2 FZD3 NOS1 DRD2 CHRM5 CSPG5 CACNA1C CHRNA7 DBH NPAS3 SLC17A1 ZDHHC8 HIST1H2BJ GRM7 AHI1 MYT1L PPP3CC SLC17A7 HSPA12A PADI2 DAO HIST1H2AH FABP7 SHISA5 PER1 SYNGAP1 PCDH8 SLC17A3 ZNF74 CSF2RB DRD1 CCKAR YWHAZ KREMEN1 SYN2 SRR GNAL ARHGAP18 GRID1 DRD5 HIST1H2AG HOMER1 GABRA1 MYH9 BTN3A1 KMO FXYD6 MC5R SP4 MAP6 SLC18A2 NTNG2 ATP6 NUMBL SPARCL1 TH TSPAN8 KCNN3 ZNF804A ADAM12 DGCR2 IL1A DTNBP1 POM121L2 ERBB4 SNAP29 ADCYAP1 CHN2 GRIN2C TSPO PDE4B JARID2 ERBB2 FEZ1 GRIA4 ASTN1 MLC1 HTR6 UHMK1 TPH1 SYT11 FBXL21 HTR2A ADSS HOMER2 ERBB3 PLAA TUBA8 MUTED VRK2 DRD4 ALDH1A2 PEMT MAP4 DAOA NDE1 HTR1A HTR7 CLOCK PDE4D NRXN1 GNL3 MICB MEGF10 GRM3 SYN3 SLCO6A1 NOTCH4 DLX1 ASCL6 GNB1L GRIN2A HTR5A QK1 PRSS16 PLA2G4C SYNGR1 UFD1L KPNA3 ANK3 TXNDC5 GRIA3 MAPK14 OPRM1 BTN2A2 GRIN2B GRIN1 HRH2 KCNH2 RAPGEF6 CYTB CSF2RA PCM1 CABIN1 DRD3 ARVCF GRP78 HTR2C NRG1 ND2 YWHAE MPZL1 GRIK3 AK1 PLXNA2 NDEL1 PPP1R1B NTF3 GRIN2D DGCR6 FXR1 SIRT5 GABBR1 DKK4 GRM4 IMPA2 TRAF3IP1 RGS4 GCLM GRM5 NDUFV2 ARHGEF10 SMARCC1 PNPO NPTN NRG3 ASTN2 NOS1AP EGR2 FGF14 GABRB2 ENO2 PTBP2 NTNG1 CDKN2A BRD1 11458

    Associated wiith schizophrenia in adulthood

    Filter Schizophrenia

    Bipolar disorder ATPA), glutamic acid decarboxylase-65 (GAD65A),in progress    
    Bornavirus       Bipolar IMPA2 NRG1 PCLO PER1 SYNGR1 TPH1 20275
    Bornavirus serpositivity and presence in brain in bipolar disorder    
    HSV-2   ?

    Schizophrenia

     

    63 Bipolar disorder susceptibi;ity gene products with homology to HSV-2 proteins

    ABCA13 ANK3 ASTN2 BRD1 CABIN1 CACNA1C CDKN2A CHRNA7 COMT CSF2RB DAO DAOA DGCR6 DISC1 DRD1 DRD2 DRD3 DTNBP1 FABP7 GABRA1 GABRB2 GNB1L GNL3 GPR78 GRID1 GRIN1 GRIN2A GRM3 GRM4 GRM7 HIST1H2BJ HTR2A HTR5A HTR6 IMPA2 MC5R MLC1 NDUFV2 NOS1AP NPAS3 NRG1 NRXN1 PDE4B PDLIM5 POM121L2 PPP3CC RELN RGS4 RPGRIP1L RTN4R SLC18A2 SNAP29 SP4 SYN3 SYNGR1 TAAR6 TH TSNAX TSPAN8 TUBA8 UFD1L ZDHHC8 ZNF74 ZNF804A

     
     
      There is considerable overlap between the genes involved in bipolar disorder and schizophrenia so the schizophrenia search filter also returbed a number of Bipolar disorder related gene products
    Rubella   64 Bipolar disorder susceptibi;ity gene products with homology to Rubella proteins ABCA13 ANK3 ASTN2 BRD1 CABIN1 CACNA1C CDKN2A CHRNA7 COMT CSF2RB DAO DAOA DGCR6 DISC1 DRD1 DRD2 DRD3 DTNBP1 FABP7 GABRA1 GABRB2 GNB1L GNL3 GPR78 GRID1 GRIN1 GRIN2A GRM3 GRM4 GRM7 HIST1H2BJ HTR2A HTR5A HTR6 IMPA2 MC5R MLC1 NDUFV2 NOS1AP NPAS3 NRG1 NRXN1 PDE4B PDLIM5 POM121L2 PPP3CC RELN RGS4 RPGRIP1L RTN4R SLC18A2 SNAP29 SP4 SYN3 SYNGR1 TAAR6 TH TSNAX TSPAN8 TUBA8 UFD1L ZDHHC8 ZNF74 ZNF804A  
      Filter schizophrenia also returns Bipolar genes
      Not well studied compared to schizophrenia, but scattered case and antibody reports (very)
    Varicella Ditto 64 Bipolar disorder susceptibi;ity gene products with homology to Varicella proteins ABCA13 ANK3 ASTN2 BRD1 CABIN1 CACNA1C CDKN2A CHRNA7 COMT CSF2RB DAO DAOA DGCR6 DISC1 DRD1 DRD2 DRD3 DTNBP1 FABP7 GABRA1 GABRB2 GNB1L GNL3 GPR78 GRID1 GRIN1 GRIN2A GRM3 GRM4 GRM7 HIST1H2BJ HTR2A HTR5A HTR6 IMPA2 MC5R MLC1 NDUFV2 NOS1AP NPAS3 NRG1 NRXN1 PDE4B PDLIM5 POM121L2 PPP3CC RELN RGS4 RPGRIP1L RTN4R SLC18A2 SNAP29 SP4 SYN3 SYNGR1 TAAR6 TH TSNAX TSPAN8 TUBA8 UFD1L ZDHHC8 ZNF74 ZNF804A  
       
       
    Rhinovirus  

    63 Bipolar disorder susceptibi;ity gene products with homology to Rhinovirus proteins

    CIT CLDN5 CNTNAP2 DGKI PRSS16 TDO2 ANK3 ASTN2 CABIN1 CACNA1C CDKN2A CHRNA7 COMT CSF2RB DAO DAOA DGCR6 DRD1 DRD2 DTNBP1 FABP7 GABRA1 GABRB2 GNB1L GNL3 GPR78 GRID1 GRIN1 GRIN2A GRM3 GRM4 GRM7 HIST1H2BJ HTR2A HTR5A HTR6 IMPA2 MC5R MLC1 NDUFV2 NOS1AP NPAS3 NRXN1 PDE4B PDLIM5 POM121L2 PPP3CC RELN RGS4 RPGRIP1L RTN4R SLC18A2 SNAP29 SP4 SYN3 TAAR6 TH TSNAX TSPAN8 TUBA8 UFD1L ZDHHC8 ZNF74 ZNF804A

     
       
       
    T.Gondii          

    63 Bipolar disorder susceptibi;ity gene products with homology to T.Gondii proteins

    ABCA13 ANK3 ASTN2 BRD1 CABIN1 CACNA1C CDKN2A CHRNA7 COMT CSF2RB DAO DAOA DGCR6 DISC1 DRD1 DRD2 DRD3 DTNBP1 FABP7 GABRA1 GABRB2 GNB1L GNL3 GPR78 GRID1 GRIN1 GRIN2A GRM3 GRM4 GRM7 HIST1H2BJ HTR2A HTR5A HTR6 IMPA2 MC5R MLC1 NDUFV2 NOS1AP NPAS3 NRG1 NRXN1 PDE4B PDLIM5 POM121L2 PPP3CC RELN RGS4 RPGRIP1L RTN4R SLC18A2 SNAP29 SP4 SYN3 SYNGR1 TAAR6 TH TSNAX TSPAN8 TUBA8 UFD1L ZDHHC8 ZNF74 ZNF804A

     
     
       
    Cervical Cancer            
             
    Human papillomavirus RTRX7 NC_004761.1|   TG HPHP None   632
     
    Human papillomavirus RTRX7 NC_004761.1|
      Cervical cancer Cervical cancer oncogenes and other growth and cancer related genes 4777
    Chronic fatigue and prostate cancer        
    Xenotropic MuLV-related virus VP62 NC_007815 XMRV TG HP None Prostate cancer related proteins and mitochondrial respiration SRCAP 284
    AIDS Neuro      
     
    HIV-1   TG   Immune C3 C4A C4B CCR2 CXCL3 CXCR4 CD44 CD288 FCGR2B HLA-F IDO2 IRF9 ITGA4 LILRB2 LY96 MOG NCR1 TCRB TLR5 5131
    Huntington's disease, spinocerebellar ataxias, Kennedy disease  

    PolyQ

    (25aa)

    VBYF P None Aspergillus niger Candida albicans Cryptococcus neoformans Lactococcus Neurospora crasse Saccharomyces cerevisiae Vibrio 1983
    Parkinson's disease        
    Coronavirus Ref TG HP

    Parkinson

    Those with evident relevance (PD genes , dopamine , growth factors, free radical, glutathione are highlighted in blue)

    SEMA5A CLTA ITGA8 DDIT4 MAPT NQO1 GRIN1 SRGAP3 TTC39B CHP CP FAM58A MRPS9 SNCA PLA2D6 TEAP2D MINK1 SNCAIP CRYZ CPLX1 ST13 MAOB GCHI PDXXK GLUD2 MTIF3 NUCKS1 TBKBP1 TH USP24 CDNF KLK6 BST1 EN2 CD38 HPCA HAOO MTNR1A HTRA2 SOD2 PACRG NFE2L2 IMP5 SLC45A3 FARP1 TPRG1 KIAA1267 RAB7L1 SLC41A1 FAM47E USP40 KEAP1 HOMER1 NSF STAP1 GNPTG EPHA4 MAP3K10 DECR1 LOC728392 MSX1 NPTX2 GSTO2 GBA SYT11 LMX1B HSPA9 OGG1 RNF19A TDP2 UCHL1 PDCD2 BDNF PSCM4 SPSB2 PLA2G6 SIAH1 SNCG PARK7 TASP1 CALB1 NTNG1 C11orf57 C10orf32 TFB1M USP41 NEBL EPHX1 RNASEH2B HNMT MMRN1 POLG LY6E ATP13A2 PLXNC1 MEF2D MANF GPR37 MRAS ACCN1 AMIGO2 EN1 NAT2 CYB1B1 THTPA PINK1 PSMC4 GRIN2B ASCL1 SLC2A13 NEUROG2 CYorf15B TRAPPC4 ARTN CAPN1 ISM1 SEPT4 MAOA ND6 PHACTR2 EPHB1 TFAM CAST EIF4EBP1 PM20D1 CD200R1 LRRK1 LINGO1 CNTNAP4 PARK2 GPRIN3 PAK7 CNNM2 SFXN2 TRAF3IP2 RRAS2 OCIAD1 HIST1H1C DDHD1 DBH C7orf41 FGF20 TFB2M GSTM3 ASRGL1 DBNDD2 GIGYF2 LMX1A DRD3 PITX3 STBD1 C17orf80
    21677
    HSV-1   Parkinson   46422